KEGG   Mus musculus (mouse): 20963Help
Entry
20963             CDS       T01002                                 

Gene name
Syk, Sykb
Definition
(RefSeq) spleen tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04611  Platelet activation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05152  Tuberculosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20963 (Syk)
   04072 Phospholipase D signaling pathway
    20963 (Syk)
   04151 PI3K-Akt signaling pathway
    20963 (Syk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    20963 (Syk)
   04625 C-type lectin receptor signaling pathway
    20963 (Syk)
   04650 Natural killer cell mediated cytotoxicity
    20963 (Syk)
   04662 B cell receptor signaling pathway
    20963 (Syk)
   04664 Fc epsilon RI signaling pathway
    20963 (Syk)
   04666 Fc gamma R-mediated phagocytosis
    20963 (Syk)
  09158 Development
   04380 Osteoclast differentiation
    20963 (Syk)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    20963 (Syk)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    20963 (Syk)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    20963 (Syk)
   05167 Kaposi sarcoma-associated herpesvirus infection
    20963 (Syk)
   05169 Epstein-Barr virus infection
    20963 (Syk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20963 (Syk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     20963 (Syk)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SYK family
   20963 (Syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 20963
NCBI-ProteinID: NP_001185906
MGI: 99515
Ensembl: ENSMUSG00000021457
Vega: OTTMUSG00000031741
UniProt: P48025 Q3UPF7 Q6P1E0
LinkDB All DBs
Position
13 A5; 13 27.41 cM
AA seq 629 aa AA seqDB search
MAGSAVDSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKA
HHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQT
VLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGAQMGHPGSPNAHPVTWSPGGIISRIKSYSFPKPGHKKP
APPQGSRPESTVSFNPYEPTGGPWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLD
RSLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLE
ESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINY
YKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMN
LCWTYDVENRPGFTAVELRLRNYYYDVVN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagtgctgtggacagcgccaaccacctgacctacttttttggcaacatcacc
cgggaagaggctgaagactacctggtccagggaggcatgaccgatgggctctacctgcta
cgccagagccgcaattacctgggtggttttgctttgtcggtggctcacaacaggaaggca
caccactacaccatcgagagggaacttaatggcacctacgccatctccgggggcagggcc
catgccagcccagcagacctctgccattaccactcccaggaacctgatggccttatctgc
ctccttaagaagcccttcaaccggcccccgggagtacagcccaagaccggaccctttgag
gacctgaaggagaacctcatcagggaatatgtgaaacagacctggaaccttcagggccag
gctctggagcaagccatcatcagccagaagccccagctggagaagctgatcgccaccacg
gcccatgagaagatgccctggttccatggcaacatctccagagatgaatcagagcagacg
gtcctcatagggtcaaagaccaatggaaaattcctgatcagggccagagacaacagcggc
tcctatgctctgtgcctgctgcacgaagggaaagtattgcactaccgcattgacagggac
aagaccgggaagctctccattcctgaggggaagaagtttgacaccctctggcagctagtg
gaacattactcttacaagccagatgggctactaagagtcctcacggtaccatgccaaaag
attggtgcacagatgggccacccaggaagcccaaatgcccatcccgtgacttggtcaccg
ggtggaataatctcaaggatcaaatcctactccttcccaaagcctggccacaaaaagcct
gccccaccccaagggagccgtccagagagcactgtgtccttcaacccctatgagccaacg
ggagggccctggggcccagacagaggccttcagagagaagccctgcccatggacacagag
gtgtacgagagcccttatgctgaccctgaagagatccggcccaaagaggtctacctggac
aggagcctgctgaccctggaggacaatgaactgggctccggtaacttcgggactgtgaaa
aagggatactaccaaatgaaaaaagttgtgaaaaccgtggctgtgaaaatcctgaagaac
gaggccaacgacccggctttgaaggacgagctgctggcagaggcgaacgtcatgcagcag
ctggacaacccctacattgtgcgcatgatcggaatctgcgaggcggagtcctggatgctg
gtgatggagatggcggagctggggccgctcaacaagtacctgcagcagaacaggcacatt
aaggataagaacatcatagagctggttcaccaggtttccatggggatgaagtatttggaa
gagagcaactttgtgcacagagatctggctgcgcggaacgtgcttctggtcacacagcac
tatgccaagatcagcgatttcggtctttccaaagccctgcgtgctgatgaaaactactac
aaggcccagacccacgggaagtggcccgtgaagtggtacgcccccgaatgcatcaactac
tacaagttctccagtaagagtgacgtctggagcttcggagtcctgatgtgggaagcgttc
tcctatgggcagaagccctacagagggatgaaagggagcgaagtgaccgccatgctggag
aaaggagagcggatggggtgccctgcaggatgcccgagagagatgtacgacctgatgaac
ctgtgctggacttacgatgtggagaacaggccaggattcacagctgtggaactgaggctt
cgcaattactactacgacgtggttaactaa

DBGET integrated database retrieval system