KEGG   Mus musculus (mouse): 210045
Entry
210045            CDS       T01002                                 

Gene name
Nlrp4b, AU022726, E330024M09, Na, Nalp, Nalp-gamma, Nalp4b
Definition
(RefSeq) NLR family, pyrin domain containing 4B
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    210045 (Nlrp4b)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    210045 (Nlrp4b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    210045 (Nlrp4b)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   210045 (Nlrp4b)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 LRR_8 LRR_4 AAA_30 AAA_14
Other DBs
NCBI-GeneID: 210045
NCBI-ProteinID: NP_766069
MGI: 3056570
Ensembl: ENSMUSG00000034087
Vega: OTTMUSG00000027117
UniProt: Q8C6J9
LinkDB
Position
7; 7 A1
AA seq 863 aa
MASLFSDFGFIWYWKELNKIEFMYFKELLIHEILQMGLKQISWTEVKEASREDLAILLVK
HCDGNQAWDTTFRVFQMIGRNVITNRATGEIAAHSTIYRAHLKEKLTHDCSRKFNISIQN
FFQDEYDHLENLLVPNGTENNPKMVVLQGVAGIGKTILLKNLMIVWSEGLVFQNKFSYIF
YFCCHDVKQLQTASLADLISREWPSPSAPMEEILSQPEKLLFIIDSLEGMEWNVTQQDSQ
LCYNCMEKQPVNVLLSSLLRKKILPESSLLISTSCETFKDLKDWIEYTNVRTITGFKENN
INMCFHSLFQDRNIAQEAFSLIRENEQLFTVCQAPVVCYMVATCLKNEIESGKDPVSICR
RTTSLYTTHILNLFIPHNAQNPSNNSEDLLDNLCFLAVEGMWTDISVFNEEALRRNGIMD
SDIPTLLDIGILEQSRESENSYIFLHPSVQEFCAAMFYLLHSEMDHSCQGVYFIETFLFT
FLNKIKKQWVFLGCFFFGLLHETEQEKLEAFFGYHLSKELRRQLFLWLELLLDTLHPDVK
KINTMKFFYCLFEMEEEVFVQSAMNCREQIDVVVKGYSDFIVAAYCLSHGSALTDFSISA
QNVLNEELGQRGKLLILWHQICSVFLRNKDIKTLRIEDTIFNEPVFKIFYSYLKNSSCIL
KTLVAYNVSFLCDKRLFLELIQSYNLEELYLRGTFLSHSDVEMLCDILNQAECNIRILDL
ANCSLCEHSWDYLSDVLRQNKSLRYLNISYNNLKDEGLKALCRALTLPNSALHSLSLEAC
QLTGACCKDLASTFTRYKCLRRINLAKNSLGFSGLFVLCKAMKDQTCTLYELKLRMADFD
SDSQEFLLSEMERNKILSIENGV
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggcatctctgttttcagattttggctttatatggtactggaaagagctaaacaagata
gaattcatgtattttaaggaattactcatacatgaaattctgcaaatgggtctaaaacag
atttcttggactgaagtaaaggaagcatctcgggaagaccttgccatcttactggtaaaa
cattgtgacgggaatcaagcctgggatacgaccttcagagtcttccagatgattgggagg
aatgttatcactaatagggcaacaggagagattgctgcacactcaacaatatatcgagct
catttaaaggagaagctgacccatgattgttctagaaagttcaacatcagtattcagaat
ttcttccaggatgaatatgatcatcttgagaaccttcttgtaccaaatggaactgaaaac
aatccaaagatggttgtcctgcaaggtgtagctggaattggcaagactattctgttaaaa
aatttaatgattgtctggtcagaaggcctggtatttcagaacaaattctcttatatcttc
tacttctgctgtcatgatgtgaagcaattgcagacagcaagcctggctgatctgatctcc
agagagtggcctagcccctcagctcccatggaggagatcctatcccaacctgagaaactc
ttattcatcattgacagcttagaagggatggaatggaatgttacccaacaggattcgcag
ctgtgttacaattgcatggagaagcagccagtaaatgtattgctgagcagtttgctcagg
aagaagatactccctgaatcatctctcctcatctccactagttgtgagacttttaaggat
ttgaaggactggattgagtacacaaatgtgagaacaataaccggattcaaggaaaacaat
attaatatgtgtttccacagcttgttccaagataggaacattgcccaggaggccttcagt
ttgataagagaaaatgagcagctgttcactgtatgtcaggcccctgtggtctgctacatg
gtggctacttgtcttaaaaatgagatagagagtggaaaagacccagtctccatctgccga
cgtaccacctccctgtataccactcacatcttaaatttgttcattccccacaatgcccaa
aatccaagtaacaatagcgaagacctgctggataacttgtgttttctagctgtagagggc
atgtggactgatatatctgtgtttaatgaggaggctctaaggagaaatgggatcatggat
tctgacatccccacactgctggatattggaattcttgagcagagcagggaatctgaaaat
tcttacatattcctccacccgtctgtccaggagttctgtgcggccatgttttatctgcta
catagtgaaatggatcactcttgtcagggtgtttactttatagaaacattcctgtttact
tttctaaacaagatcaaaaaacagtgggtttttttgggctgtttcttctttggtctttta
catgaaacagaacaagaaaagctggaggcattttttggctaccacttatctaaagaatta
aggcgacagttgtttttgtggctggaactcctattggacactttacatcctgacgtaaaa
aaaataaataccatgaagttcttttactgtctgtttgagatggaagaggaagtctttgta
cagtcagcaatgaactgtagggaacagattgacgttgtggttaagggttattctgatttt
attgttgctgcctactgcttaagccatggctctgcactgacagacttctccatttcagct
caaaatgtgctgaatgaagagctaggccagaggggaaagctactcatactttggcatcaa
atatgctctgtgttcctaaggaataaagatatcaaaacactcagaatagaagacactatt
ttcaatgaaccagtctttaaaatcttttattcttatttgaagaactccagctgtatcctt
aaaacacttgtggcatataatgtttcctttttatgtgataagcgcctattcttggaattg
attcaaagctacaatttggaggaattgtatctcagaggcacattcctctcccacagtgat
gtggaaatgttgtgtgatatcttgaaccaggcagagtgcaacatacgcatactggattta
gctaactgttccctctgtgagcattcttgggactacctttctgatgttcttaggcagaac
aaatccctgagatacctaaacatcagctacaataacctgaaggatgaagggctgaaggct
ctctgtagagctctgactctcccaaactctgctctgcattcactaagtttggaagcctgt
caactgactggtgcctgttgtaaggaccttgcttctacttttacgcgatataaatgcctg
cggaggatcaacctggcgaagaactccttgggcttcagtggattgtttgtgctgtgtaag
gctatgaaagaccaaacgtgtaccttgtatgagctaaaactgcgaatggctgactttgat
agcgattcccaggaatttctactttctgagatggaaagaaataaaatcttgagcatcgaa
aatggtgtgtaa

DBGET integrated database retrieval system