KEGG   Mus musculus (mouse): 210992
Entry
210992            CDS       T01002                                 

Gene name
Lpcat1, 2900035H07Rik, Aytl2, BB137372, BC005662, C87117, LPCAT, LPCAT-1, lysoPAFAT, mLPCAT1, rd11
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    210992 (Lpcat1)
   00565 Ether lipid metabolism
    210992 (Lpcat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    210992 (Lpcat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     210992 (Lpcat1)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     210992 (Lpcat1)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   210992 (Lpcat1)
SSDB
Motif
Pfam: Acyltransferase EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 210992
NCBI-ProteinID: NP_663351
MGI: 2384812
Ensembl: ENSMUSG00000021608
Vega: OTTMUSG00000033733
UniProt: Q3TFD2
LinkDB
Position
13; 13 C1
AA seq 534 aa
MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLF
AAFMMLLAWPFALLASLGPPDKEPEQPLALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGR
QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQ
DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPN
KLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAK
ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESAR
MKRGEKIRLPEFAAYLEVPVSDALEDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLAT
IQLAFKMYGSPEDGSIDEANLSCILKTALGVSELTVTDLFQAIDQEDKGRITFDDFCGFA
EMYPDYAEDYLYPDQTHFDSCAQTPPAPTPNGFCIDFSPENSDFGRKNSCKKAD
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaggctgcggggccgcgggccgcgggccgccccctcctccagctctggggcaggcgac
gcgcggcgcctagcgcccccggggcggaaccccttcgtgcacgagctgcgactgagcgcc
ctgcagaaggcccaggtggctttcatgacgttgacgctgttccccatccggctcctgttc
gctgctttcatgatgctgctggcctggccctttgcactcctggcttccctgggacctcct
gataaggagccagagcagcccctggccttatggaggaaggtcgtggacttcctgctcaag
gccatcatgcgcaccatgtggtttgctggcggcttccaccgtgtagctgtgaaggggcgg
caggccctgcctactgaggctgctatcctcaccttggctccacattcctcctactttgat
gccatcccggtcaccatgaccatgtcctccattgtgatgaaggcagagagcagagacatc
ccaatctggggaactctgataagatacatcaggccagtgttcgtgtcccgctctgaccag
gactcgcgaaggaagacagtggaggagatcaagcgacgggcacagtcgaatggaaagtgg
cctcagataatgatttttccagaaggaacttgtacaaataggacctgcctcattaccttc
aaacctggtgcgttcattcctggagttcctgtccagcccgtggtgctacgctacccaaac
aaattggacaccatcacatggacgtggcaaggacctggagcgttgaaaatcctgtggctc
actctgtgccagtttcaaaaccaagtggaaattgaatttctgcctgtgtattgcccttct
gaagaggagaagaggaatcctgccctgtatgccagcaatgtgaggcgtgtcatggccaag
gccctgggtgtctcagtaaccgactatacatttgaggactgccagctggctctggcagaa
ggacaacttcgcttgcctgctgacacctgcctgctagagtttgccaggcttgtgaggggc
ctcggactaaaaccagaaaatcttgaaaaagatctagacaaatattcagaaagtgcgagg
atgaagagaggagagaaaatccgccttccagagtttgcggcctacttggaagttcctgtc
tcagatgcactggaagacatgttctcgctttttgacgagagtggtggtggtgagattgac
cttcgtgaatatgtggtcgccttgtctgtggtgtgcaggccatcccagaccttagccacc
atccagctggcattcaagatgtacggatctcctgaggatggcagcatagatgaggccaac
ctgtcctgcatcctcaagactgcactgggtgtatcagaattaacagtgaccgacttgttc
caggctattgaccaagaggacaagggaagaatcacctttgatgacttctgcgggtttgcg
gaaatgtaccccgactacgcagaggactacttgtaccctgatcagacacatttcgacagc
tgtgcacagacacccccagcaccaactcccaatggcttctgcattgacttcagccctgag
aactcagactttgggagaaagaattcttgtaagaaagcggactag

DBGET integrated database retrieval system