KEGG   Mus musculus (mouse): 211323
Entry
211323            CDS       T01002                                 

Gene name
Nrg1, 6030402G23Rik, ARIA, D230005F13Rik, GGF, GGFII, HG, HR, HRG, HRGalpha, Hgl, ND, NDF, SMD, SMDF, hereg
Definition
(RefSeq) neuregulin 1
  KO
K05455  neuregulin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04012  ErbB signaling pathway
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    211323 (Nrg1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    211323 (Nrg1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    211323 (Nrg1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   211323 (Nrg1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   211323 (Nrg1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 BiPBP_C DUF973 Ig_4 Cyt_b-c1_8
Other DBs
NCBI-GeneID: 211323
NCBI-ProteinID: NP_001351350
MGI: 96083
Ensembl: ENSMUSG00000062991
Vega: OTTMUSG00000059179
LinkDB
Position
8; 8 A3
AA seq 645 aa
MSERKEGRGKGKGKKKDRGSRGKPAPAEGDPSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRRNKPQNVKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNDLTTGMSASTERPYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLI
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEA
EELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRQKLHDRLRQSLRSERNNMVNIANG
PHHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTSTAHHSTTVTQTPSHSW
SNGHTESIISESHSVIMMSSVENSRHSSPAGGPRGRLHGLGGPRECNSFLRHARETPDSY
RDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSVAVSPFVEEE
RPLLLVTPPRLREKKYDHHPQQLNSFHHNPAHQSTSLPPSPLRIVEDEEYETTQEYEPIQ
EPIKKVTNSRRAKRTKPNGHIANRLEMDSNPSSVSSNSESETEDERVGEDTPFLGIQNPL
AASLEVAPAFRLAESRTNPAGRFSTQEELQARLSSVIANQDPIAV
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgtctgagcgcaaagaaggcagaggcaaggggaagggcaagaagaaggaccggggatcc
cgcgggaagcccgcgcccgccgaaggcgacccgagcccagcattgcctcccagattgaaa
gagatgaaaagccaggagtcagctgcaggctccaagctcgtgcttcggtgtgaaaccagc
tctgagtactcctcactcagattcaaatggttcaagaacgggaatgagctgaaccgtagg
aataaaccacaaaacgtcaagatacagaagaagccagggaagtcagagcttcgaatcaac
aaagcgtccctggctgactctggagaatatatgtgcaaagtgatcagcaagttaggaaac
gacagtgcctctgccaacatcaccattgttgagtcaaacgacctcaccactggcatgtca
gcctcaactgaaagaccctatgtgtcctcagagtctcccattagaatatcagtttcaaca
gaaggcgcaaatacttcttcatccacatctacatccacgactgggaccagccatctcata
aagtgtgcggagaaggagaaaactttctgtgtgaatggaggcgagtgcttcatggtgaag
gacctgtcaaacccctcaagatacttgtgcaagtgcccaaatgagtttactggtgatcgt
tgccaaaactacgtaatggccagcttctacaagcatcttgggattgaatttatggaagcg
gaggagctctaccagaagagggtactgacaattactggcatctgtatcgccctgttggtg
gtcggcatcatgtgtgtggtggcctactgcaaaaccaagaaacagcggcagaagcttcat
gatcggctccggcagagccttcggtcagaacgaaacaacatggtgaacatagcgaatggc
cctcaccatccaaacccaccaccagagaatgtgcaactggtgaatcaatatgtatctaaa
aacgtcatctccagtgagcatattgtggagagagaagtggagacctccttttccaccagt
cactacacttccacagctcatcactccacgactgtcacccagactcctagtcacagctgg
agtaatgggcacacagaaagcatcatttcagaaagccactctgtaatcatgatgtcatcg
gtagagaacagcaggcacagcagcccagctgggggcccacgaggacgtcttcatggcctg
ggaggccctcgcgaatgtaacagcttcctcaggcatgccagagaaacccctgactcctac
agagactctcctcatagtgaaaggtatgtatcagccatgaccaccccggctcgtatgtca
cctgtagatttccacacgccaagctcccctaaatcgcccccttcggaaatgtctccaccc
gtgtccagcatgacggtgtccatgccctctgtggcagtcagcccctttgtggaagaagag
aggcctctgcttcttgtgacgccaccgaggctacgggagaagaagtatgatcatcacccc
cagcaactcaactcctttcatcacaaccctgcacatcagagtaccagcctcccccctagc
ccattgaggatagtggaggatgaggaatacgaaacgacccaggagtatgagccaattcaa
gagcctattaagaaagtcaccaatagccggcgggccaaaagaaccaagcccaatggccac
attgccaataggttggaaatggacagcaacccaagttctgtgagcagtaactcagaaagt
gagacagaagatgaaagagtaggtgaagatacaccattcctgggcatacagaaccccctg
gcagccagccttgaggtggcccctgccttccgtctggctgagagcaggactaacccagca
ggccgcttctccacacaggaagaattacaggccaggctgtctagtgtaatcgctaaccaa
gaccctattgctgtataa

DBGET integrated database retrieval system