KEGG   Mus musculus (mouse): 212980
Entry
212980            CDS       T01002                                 

Gene name
Slc45a3, 2210413P12Rik, AU023994, AU043764, IPC, IPCA-6, PRST, Pc, Pcanap6
Definition
(RefSeq) solute carrier family 45, member 3
  KO
K15379  solute carrier family 45, member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    212980 (Slc45a3)
   05206 MicroRNAs in cancer
    212980 (Slc45a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    212980 (Slc45a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   212980 (Slc45a3)
SSDB
Motif
Pfam: MFS_1 MFS_2 DUF553 MFS_1_like
Other DBs
NCBI-GeneID: 212980
NCBI-ProteinID: NP_001171099
MGI: 1922082
Ensembl: ENSMUSG00000026435
Vega: OTTMUSG00000049196
UniProt: Q8K0H7
LinkDB
Position
1; 1 E4
AA seq 553 aa
MIQRLWASRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVSVPLLGSASDQWRGRYGRRRPFIWALSLGVLLSLFLIPRAGWLAGLLYPDTRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAFSVYAFMISLGGCLGYLLPA
IDWDTSVLAPYLGTQEECLFGLLTLIFLICMAATLFVTEEAVLGPPEPAEGLLVSAVSRR
CCPCHVGLAFRNLGTLFPRLQQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCAISLVFSLVMDRLVQKFGTRSVYLASVM
TFPVAAAATCLSHSVVVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDAGG
SSGEDSQTTSFLPGPKPGALFPNGHVGSGSSGILAPPPALCGASACDVSMRVVVGEPPEA
RVVTGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSHSVTAYMVSAAGLGLVAIYFATQ
VVFDKNDLAKYSV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgatccagaggctgtgggccagccgtctgctacggcaccggaaagctcagctcctgctg
gtcaacctgctcacctttggcctggaggtgtgcctggctgccggcattacctatgtgcca
ccccttctgctggaagtcggggtggaggagaaattcatgaccatggtgttgggcattggc
ccagtgctaggcctggtttctgttccactcctaggctcagccagtgaccagtggcgtggg
cgctatggccgccggagaccctttatctgggctttgtccctgggtgtcctgctaagcctc
tttctcatcccgagggctggctggctggcaggactgctgtacccagacaccaggcccctg
gagttggccctgctgatcttgggagtggggctgctggacttttgtggccaggtgtgcttt
actccattggaggccttactctccgacctcttccgggacccagaccactgccgccaagcc
ttctctgtctacgccttcatgatcagccttgggggctgcctgggctacctcttacctgcc
attgactgggacaccagcgttctggccccctacctgggtactcaggaagaatgcctcttt
ggcctcctcaccctcattttcctcatctgcatggcagccactctgtttgtgacggaggag
gcagtactgggcccacccgagccggcagaagggttgttggtctctgccgtgtcgcgccga
tgctgcccatgccacgttggcctggctttccggaatctgggtaccctgtttccccggctg
cagcagctgtgctgccgcatgcctcgcaccctacgccgactctttgtggctgagctgtgc
agctggatggcacttatgactttcacactgttctacacggacttcgtgggagaggggctg
taccagggtgtacccagagccgagccaggcaccgaggcccggagacactatgatgaaggc
attcgaatgggcagcctggggctcttcctgcagtgtgccatctccctggtcttctccctg
gtcatggacaggctggtacagaagttcggcacacggtcagtctatctggccagtgtgatg
acctttcctgtggctgccgctgccacctgcctgtcccacagcgtggtggtagtgacagcc
tcagctgccctcaccgggttcaccttctcggccttgcagatcctgccttacacgctcgcc
tccctctaccaccgtgagaagcaggtgttcctgcccaaataccgaggggacgctggaggt
agcagcggtgaggacagccagacaaccagcttcttgccaggccctaagccaggagctctc
ttccccaatggacacgtgggctctggcagcagcggcatcctggcccctccacctgcactc
tgtggggcctctgcctgcgatgtctccatgcgagtggtggtgggtgagccacctgaggcc
agggttgttacgggacggggcatttgcctggacctggccattctggacagtgcctttctg
ctgtcccaggtggctccgtccctgttcatgggctccattgtccagctgagccactctgtc
actgcctatatggtatcagctgcaggcttgggtctggtcgccatttactttgctacacag
gtagtgtttgacaagaacgacttggccaaatactcagtgtag

DBGET integrated database retrieval system