KEGG   Mus musculus (mouse): 212996Help
Entry
212996            CDS       T01002                                 

Gene name
Wbscr17, AA388321, E330012B09Rik, Galnt17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17 homolog (human)
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    212996 (Wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    212996 (Wbscr17)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     212996 (Wbscr17)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   212996 (Wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 212996
NCBI-ProteinID: NP_660253
MGI: 2137594
Ensembl: ENSMUSG00000034040
Vega: OTTMUSG00000030425
UniProt: Q7TT15 Q59J92
LinkDB All DBs
Position
5; 5 G2
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWAIKNPIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgaggagagtcaaagtgttgttggtgttgaacttgatcgcggtggccggc
ttcgtgatctttttggctaagtgtcggcctatcgcggtgcgcagcggagacgccttccac
gagatccggcctcgcgcagaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcttgtcgctgctggaggacatcgtctacaggcagcttaatggc
ttatctaaatccctcgggctcatcgaagggtatggtgggaggggcaaaggaggccttcct
gccaccctttccccctctgaagaagaaaaagccaaaggacctcatgagaaatatggctac
aattcctacctcagtgaaaagatctccttggaccggtctattccagattatcgtcctacc
aagtgtaaggagctcaaatattccaaggagttgccccagatatccatcatcttcatcttc
gtgaatgaggccctgtctgtgatacttcggtcagtccacagcgctgtcaatcacacaccc
acacacctgctgaaggagatcatcctggtggatgacaacagtgatgaagaggagctgaag
gcccccttggaagagtacgtccacaaacgctaccctgggctggtgaaggtggtacgcaat
caaaagcgagaaggcctgatccgagcacgcatcgagggctggaaagcggccactggccag
gtcactggctttttcgatgctcacgtggaattcactgctggctgggctgagcccgttctg
tcccgcatccaggaaaaccggaagcgggtcatcctcccctccatcgacaacatcaagcag
gacaacttcgaagtgcagcgctacgagaactccgcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagatccctctctccccatc
agaacaccagccatgattggctgctcatttgtggtcaacaggaaattctttggtgaaatt
ggtctgctggaccctggaatggatgtgtacggaggagagaatattgaacttgggatcaag
gtatggctctgtggtggcagcatggaggtccttccatgttcaagggtggcccacattgag
cggaagaagaaaccgtataacagtaacatcggcttttacaccaagaggaatgcattgcga
gtagccgaggtctggatggacgactacaagtcacatgtgtacatagcgtggaatctgcct
ctggagaatccaggcatcgatatcggtgatgtctcagaaagaaaagcattaaggaaaagt
ttgaaatgtaagaatttccagtggtatttggaccatgtttacccagaaatgagaagatac
aacaacactatcgcctatggggagcttcgtaataataaggccaaggacgtctgtctggac
caggggccactggaaaaccacacagcaatactgtacccatgccacggttggggaccacag
ctcgcccgctacaccaaggaagggttcctgcacttaggtgctctggggaccaccactctc
ctccctgatacccgctgcctggtggacaactccaagagtcggttgccgcagctcctggat
tgtgacaaggtcaagagcagcttgtacaagcgttggaacttcatccagaatggagccatc
atgaataagggcacagggcgctgcctagaggtggagaaccggggcctggccggcatcgac
ctaatccttcgaagctgtactggacagagatgggcaatcaagaatcccatcaagtag

DBGET integrated database retrieval system