KEGG   Mus musculus (mouse): 21386Help
Entry
21386             CDS       T01002                                 

Gene name
Tbx3, D5Ertd189e
Definition
(RefSeq) T-box 3
  KO
K10177  T-box protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    21386 (Tbx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21386 (Tbx3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   T-box
    21386 (Tbx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box TBX
Motif
Other DBs
NCBI-GeneID: 21386
NCBI-ProteinID: NP_035665
MGI: 98495
Ensembl: ENSMUSG00000018604
Vega: OTTMUSG00000029655
UniProt: P70324 Q3ULL3
LinkDB All DBs
Position
5 F; 5 60.34 cM
AA seq 741 aa AA seqDB search
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEDVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFEERHKKETSDESSSEQAAFNCFAQASSPAVSIVGT
SNLKDLCPSEAESDAEAESKEEHGPEACDAAKISTTTAEEPGRDKGSPATRAQLFPAEPS
RARDTARLDKASPDSRHSPATISSSTRVPGADERRSPGREGPVATKVDEARAIPAKDAFA
PLSVQTDATAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPGQFAMGGAFSSMAAGMGPL
LATVSGASTGVSGLESTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFP
YPYTYMAAAAAASTAAASSSVHRHPFLNLNSMRPRLRYSPYSIPVPVPDSSSLLATALPS
MASAAGPLDGKAAALAASPASVAVDSGSELNSRSSTLSSGSVSLSPKLCSEKEAATSELQ
SIQRLVSGLEAKPDRSCSGSP
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctccatgagagatccggttatccctgggacaagcatggcctatcatcccttc
ctacctcaccgggcgccggacttcgccatgagcgcggtactgggccaccagccgcctttc
ttccccgcgctaacgctgcctcccaacggcgccgcggcgctctcgctccccggagctctg
gccaagcccatcatggatcagttagtgggggctgctgagaccggcatccctttctcatcc
ctgggaccccaggcacatctgaggcctctgaagaccatggaacccgaagaagacgtagaa
gatgaccctaaggtgcacctggaggccaaggaactttgggaccagtttcacaagcggggt
acagagatggtcatcacgaagtcaggaaggcgaatgttccctccgtttaaagtgaggtgc
tctggactggataaaaaggccaagtatattttattgatggacattatagctgctgacgac
tgtcgatataaatttcacaactctcggtggatggtggccggtaaggcagaccccgaaatg
ccaaagagaatgtatatacacccggacagccccgctacgggggagcaatggatgtccaaa
gtcgtcactttccacaaactgaaactcaccaacaacatatcggataaacacggatttact
ttggccttcccaagcgatcacgcaacgtggcaggggaattatagttttgggacccagact
atactaaactctatgcataagtaccagccgcggttccacatcgtcagagccaacgatatc
ctgaaactgccttacagtacttttcgaacctacctgttcccggaaacagaattcatcgcc
gttactgcctatcagaatgacaagataactcagttaaaaatagacaacaatccctttgca
aagggttttcgagacactggcaatggcaggagagaaaaaagaaagcagctcacactgcag
tccatgagagtgtttgaggagaggcataagaaggagacttcggatgagtcctccagcgag
caggcagccttcaactgctttgcccaggcatcctctcctgctgtctccatcgtggggaca
tccaacctcaaagatctgtgtcccagcgaagccgagagtgacgccgaggctgagagcaag
gaggagcacggccctgaggcctgcgacgcggccaagatttccaccactacggccgaggag
ccaggccgcgacaagggcagcccagcaaccagggcgcagctgttccccgcggagcccagc
cgggcccgcgacaccgcgcgtctggacaaggcatcgccagactcgcgccatagcccggcc
accatctcgtccagcacgcgagttccgggagctgatgagcgcaggagtcccgggcgcgag
ggtccagtcgccaccaaggtggatgaggcgcgcgcgattcctgccaaggacgccttcgct
ccactgtcggtgcagacagacgccaccgcgcacctagcgcaggggcccctcccgggcttg
ggtttcgccccaggccttgcgggccagcagttcttcaacgggcacccgctcttcctgcac
ccgggccagttcgccatgggcggcgccttctctagcatggctgcaggcatggggcccctg
ctggccacagtatccggagcatccaccggcgtctcaggcctagaatccacagccatggcc
tcggctgccgcagcgcagggactgtctggggcgtcggctgccaccctgcccttccacctc
caacaacacgttctggcctcccagggcttggctatgtcgcctttcgggagcctgtttcct
tacccctacacatacatggctgcagcagctgcagcctccaccgcggccgcctccagctcc
gtgcaccgccacccgttcctcaatttgaacagcatgcgccccaggctgcgttacagcccc
tattccatccccgtcccagtgccggatagcagcagtttgctggccacagctttaccatca
atggcttccgccgcggggcccctagacggcaaagcggccgccctggcagccagcccagcc
tcggtggctgtggactcggggtcggaactgaacagccgctcgtccacgctgtcctctggc
tcagtgtccttgtcacccaaactctgctccgagaaggaggcggctaccagcgaactgcag
agtatccagcggctggtcagtggcttggaagccaagccagacaggtcttgcagcgggtcc
ccttaa

DBGET integrated database retrieval system