KEGG   Mus musculus (mouse): 21402Help
Entry
21402             CDS       T01002                                 

Gene name
Skp1a, 15kDa, 2610043E24Rik, 2610206H23Rik, EMC19, OCP-II, OCP2, SKP1, Tceb1l, p19A, p19Skp1
Definition
(RefSeq) S-phase kinase-associated protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04710  Circadian rhythm
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    21402 (Skp1a)
   04120 Ubiquitin mediated proteolysis
    21402 (Skp1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21402 (Skp1a)
   04350 TGF-beta signaling pathway
    21402 (Skp1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    21402 (Skp1a)
   04114 Oocyte meiosis
    21402 (Skp1a)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    21402 (Skp1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21402 (Skp1a)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21402 (Skp1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    21402 (Skp1a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    21402 (Skp1a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     21402 (Skp1a)
   Cul7 complex
     21402 (Skp1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     21402 (Skp1a)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     21402 (Skp1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1 Skp1_POZ
Motif
Other DBs
NCBI-GeneID: 21402
NCBI-ProteinID: NP_035673
MGI: 103575
Ensembl: ENSMUSG00000036309
Vega: OTTMUSG00000005625
UniProt: Q9WTX5 Q5SUR3
LinkDB All DBs
Position
11 B1.3; 11 31.86 cM
AA seq 163 aa AA seqDB search
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgactatcaagaccatgctggaagatttgggaatggatgatgaagga
gatgatgatcctgttcctttaccaaatgttaatgcagcaattctaaagaaggtcattcag
tggtgcacccaccacaaagatgaccctcctcctcctgaggatgatgaaaacaaagaaaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacatgc
aagactgtggccaatatgattaaggggaaaactcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaagaggcccaggtacgcaaagagaaccaatggtgt
gaagagaagtga

KEGG   Mus musculus (mouse): 26965Help
Entry
26965             CDS       T01002                                 

Gene name
Cul1, Cul-1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04710  Circadian rhythm
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26965 (Cul1)
   04120 Ubiquitin mediated proteolysis
    26965 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    26965 (Cul1)
   04340 Hedgehog signaling pathway
    26965 (Cul1)
   04350 TGF-beta signaling pathway
    26965 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    26965 (Cul1)
   04114 Oocyte meiosis
    26965 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    26965 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26965 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26965 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26965 (Cul1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     26965 (Cul1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 26965
NCBI-ProteinID: NP_036172
MGI: 1349658
Ensembl: ENSMUSG00000029686
Vega: OTTMUSG00000022333
UniProt: Q9WTX6
LinkDB All DBs
Position
6; 6 B2.3
AA seq 776 aa AA seqDB search
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagattggtcttgaccagatc
tgggatgacctcagagctggaattcagcaggtgtataccagacaaagcatggcaaagtcc
agatacatggaactctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgttggcttggagttatacaagcgattgaaggaatttttgaagaattatttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtcctgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgccgtgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaagttgattgaaaaggaaagaaatggagaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtttgcttgaggaacagcggagagttcaggtttacctccac
gagagcacacaagatgaactagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttattggatgctgacaagaatgaagatttgggc
cgcatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcagcaattgagaagtgtggagaagctgctcta
aatgaccccaagatgtatgtgcagacagtgctggatgttcataaaaaatacaatgccctg
gtgatgtcagcattcaacaacgatgctggcttcgtagctgctcttgataaggcttgtggt
cgcttcataaacaacaatgcggttaccaaaatggcccagtcatccagtaaatcccctgag
ctgcttgctcggtactgtgactccttgctgaagaaaagttccaagaacccagaagaggca
gaactagaagacaccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcaaaacagtgcg
agtgacgatgctgaagcaagcatgatctccaagttaaagcaagcttgtggttttgagtac
acttccaaacttcagcgaatgtttcaagacattggtgtaagcaaagatctgaatgaacag
ttcaaaaaacacctgacgaattcagaaccgctggacttggacttcagtattcaggtcctg
agttctggatcgtggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttatcagcgatttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacatttcagatggcaatcctgcttcagtataacacagaagacgcctat
actgtgcagcagttgactgacagcactcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcgaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaactacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaaa
atgaggaaggtcctgaaacaccagcagttacttggtgaagtcctcactcagctctcctcc
aggttcaaacctcgggtcccggtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

KEGG   Mus musculus (mouse): 56438Help
Entry
56438             CDS       T01002                                 

Gene name
Rbx1, 1500002P15Rik, AA517855, ROC1
Definition
(RefSeq) ring-box 1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04066  HIF-1 signaling pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04710  Circadian rhythm
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56438 (Rbx1)
   04120 Ubiquitin mediated proteolysis
    56438 (Rbx1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    56438 (Rbx1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    56438 (Rbx1)
   04350 TGF-beta signaling pathway
    56438 (Rbx1)
   04066 HIF-1 signaling pathway
    56438 (Rbx1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56438 (Rbx1)
   04114 Oocyte meiosis
    56438 (Rbx1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    56438 (Rbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56438 (Rbx1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    56438 (Rbx1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    56438 (Rbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56438 (Rbx1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    56438 (Rbx1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     56438 (Rbx1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   56438 (Rbx1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     56438 (Rbx1)
   ECV complex
     56438 (Rbx1)
   Cul3 complex
     56438 (Rbx1)
   Cul4 complex
     56438 (Rbx1)
   Cul7 complex
     56438 (Rbx1)
   Cul9 complex
     56438 (Rbx1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      56438 (Rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      56438 (Rbx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 56438
NCBI-ProteinID: NP_062686
MGI: 1891829
Ensembl: ENSMUSG00000022400
UniProt: P62878
LinkDB All DBs
Structure
PDB: 

Position
15; 15 E1
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgatggatgtggatacccccagcggcaccaacagcggcgcgggcaagaag
cgctttgaagttaaaaagtggaatgcagtggccctctgggcctgggacattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgtatcgaatgtcaggccaaccag
gcgtcagctacttccgaagagtgtacggttgcatggggagtctgcaaccatgcttttcat
ttccactgcatctctcgatggctcaaaacgaggcaggtgtgtccgttggacaacagagag
tgggagttccagaagtatgggcattag

DBGET integrated database retrieval system