KEGG   Mus musculus (mouse): 21414Help
Entry
21414             CDS       T01002                                 

Gene name
Tcf7, AI465550, TCF-1, Tcf1
Definition
(RefSeq) transcription factor 7, T cell specific
  KO
K02620  transcription factor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21414 (Tcf7)
   04390 Hippo signaling pathway
    21414 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21414 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    21414 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21414 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21414 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21414 (Tcf7)
   05225 Hepatocellular carcinoma
    21414 (Tcf7)
   05226 Gastric cancer
    21414 (Tcf7)
   05216 Thyroid cancer
    21414 (Tcf7)
   05221 Acute myeloid leukemia
    21414 (Tcf7)
   05217 Basal cell carcinoma
    21414 (Tcf7)
   05215 Prostate cancer
    21414 (Tcf7)
   05213 Endometrial cancer
    21414 (Tcf7)
   05224 Breast cancer
    21414 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    21414 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    21414 (Tcf7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21414 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21414 (Tcf7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21414 (Tcf7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2
Motif
Other DBs
NCBI-GeneID: 21414
NCBI-ProteinID: NP_001300910
MGI: 98507
Ensembl: ENSMUSG00000000782
Vega: OTTMUSG00000005622
UniProt: Q00417 Q80UF1
LinkDB All DBs
Position
11 B1.3; 11 31.86 cM
AA seq 303 aa AA seqDB search
MYKETVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPA
PTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAE
KEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYEL
ARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPM
TVL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagagactgtctactctgccttcaatctgctcatgccctacccaccggcctcc
ggagcagggcagcatccgcagcctcaacccccgctgcataacaagcccggccagcctcca
catggcgtcccccagctttctccactctacgaacatttcagcagtccacaccccacccct
gcaccagcggacatcagccagaagcaaggagttcacaggccgctgcagacccccgatctc
tctggattttattctctgacctcaggcagcatgggacagctcccccatactgtgagctgg
cccagtcctcctctctaccccctgtccccttcctgcggatatagacagcacttccctgcc
cccactgcagcccctggcgccccctatcccaggttcacccacccatccttgatgctggga
tctggtgtacctggacacccagcagccatccctcacccggccattgtgccctcctcaggg
aagcaggagctgcagccatatgatagaaacctgaaaacacaggcagaacccaaggcagag
aaggaggctaagaagccagtcatcaagaaacccctcaatgcgttcatgctttacatgaag
gagatgagagccaaggtcattgctgagtgcacactcaaggagagcgctgccatcaaccag
atcctgggtcgcaggtggcatgcactatctcgagaagagcaggccaagtactatgaactg
gcccgcaaggaaaggcagctgcacatgcagctatacccgggctggtccgcgcgggataac
tacggaaagaagaagaggcggtcaagggaaaaacatcaagaatccaccacaggaggaaaa
agaaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccgatg
acagtgctctag

DBGET integrated database retrieval system