KEGG   Mus musculus (mouse): 21423Help
Entry
21423             CDS       T01002                                 

Gene name
Tcf3, A1, AA408400, ALF2, AW209082, E12, E12/E47, E2A, E47, KA1, ME2, Pan1, Pan2, TCF-3, Tcfe2a, VDIR, bHLHb21
Definition
(RefSeq) transcription factor 3
  KO
K09063  transcription factor E2-alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05166  Human T-cell leukemia virus 1 infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    21423 (Tcf3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    21423 (Tcf3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21423 (Tcf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21423 (Tcf3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Ubiquitous (class A) factors
    21423 (Tcf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 21423
NCBI-ProteinID: NP_001157621
MGI: 98510
Ensembl: ENSMUSG00000020167
Vega: OTTMUSG00000019126
UniProt: P15806
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 651 aa AA seqDB search
MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSW
GSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGT
LSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPG
LPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPM
LGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGT
SGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQG
LPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHG
ALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSY
SGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQK
AEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLE
QQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccagtctcagagaatggcacccgtgggctctgacaaggaactgagtgacctc
ctggacttcagcatgatgttcccgctacctgtggccaatgggaagagccggcccgcctcc
ctcgggggaacccagtttgcaggctcaggactggaggaccgacccagctcaggctcctgg
ggcagcagtgaccagaacagttcttcctttgaccctagccggacatacagcgaaggtgcc
cacttcagtgactcccacagcagcctgccgccttccacgttcctaggagctgggcttgga
ggcaagggcagtgagcggaatgcctatgccacctttgggagagacaccagtgttggcacc
ttgagtcaggctggcttcctgccaggtgagctgagcctcagcagtcccgggccactgtcc
ccatcgggcatcaagagcagctcccagtattacccctcattccccagcaaccctcgtcgg
agagctgcagatggtggcctggatactcagccgaagaaggtccggaaggttccgcctggt
ctcccttcctcggtgtatccgcccagctcaggtgacagctacagcagggatgctgcagcc
tacccctccgccaagacccccagcagcgcttacccctcccccttctacgtggcagatggc
agcctgcacccatcagctgagctctggagtacgcctagccaggtgggctttgggcccatg
ctaggtgacggctcttcccctctgccccttgcaccgggcagcagctccgtgggcagtggt
acctttgggggcctccagcagcaggatcgcatgggctaccagctgcatggatctgaggtt
aatggctcgctcccagctgtatccagcttttcggctgcccctggcacttacagtgggact
tccggccacacgccccctgtgagtggggccgcagctgaaagcctcctaggcacccgaggg
actacagccagcagctcaggggatgcccttgggaaggcactggcctcgatctactccccg
gatcactccagcaataatttctcacctagcccctcaacgcctgtgggttcaccccagggc
ctgccagggacatcacagtggccccgggcaggagcgcccagtgccttatcccccaactac
gatgcaggtctccatggcctgagcaagatggaggaccgcttggacgaggccatccatgtc
ctgcgaagccacgctgttggcaccgctagcgatctccatgggcttttgcctggccatggc
gcactgaccacgagcttcaccggccccatgtcactgggcgggcggcatgccggcctggtc
gggggaagccatcctgaggagggcctcacaagtggggccagtcttttgcataaccatgcc
agcctccccagccagcccagttccctccctgacctctcacagagacctcccgactcctat
agtggactcgggagggcaggcacaacagcgggtgccagcgagatcaagcgggaggagaaa
gaggatgaggaaatcgcatcagtagccgacgccgaagaggacaagaaggacctgaaggtc
ccacgcacgcgcaccagcccagacgaggacgaggacgaccttctccccccagagcagaag
gcggagcgggagaaggagcgccgggtggccaataatgcccgagagcgcctgcgggtccgc
gacatcaatgaggcctttaaggagctcggccgcatgtgccagctgcacctcagcagcgag
aagccgcagaccaaactgctcatcctgcaccaggccgtggccgtcatcctcagcctggag
cagcaggtgcgagaacgcaacctgaaccccaaagcagcctgcttgaagcggagggaggag
gagaaggtgtctggcgtggtcggggacccacagctggccctgtcagccgcccacccgggc
ctgggtgaggcccacaacccagccgggcacctgtga

DBGET integrated database retrieval system