KEGG   Mus musculus (mouse): 214763
Entry
214763            CDS       T01002                                 

Gene name
Cgas, E330016A19Rik, Mb21d1
Definition
(RefSeq) cyclic GMP-AMP synthase
  KO
K17834  cyclic GMP-AMP synthase [EC:2.7.7.86]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    214763 (Cgas)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    214763 (Cgas)
   05171 Coronavirus disease - COVID-19
    214763 (Cgas)
   05168 Herpes simplex virus 1 infection
    214763 (Cgas)
   05163 Human cytomegalovirus infection
    214763 (Cgas)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.86  cyclic GMP-AMP synthase
     214763 (Cgas)
SSDB
Motif
Pfam: Mab-21 RasGAP_C Spc29 SMODS DUF4699
Other DBs
NCBI-GeneID: 214763
NCBI-ProteinID: NP_775562
MGI: 2442261
Ensembl: ENSMUSG00000032344
Vega: OTTMUSG00000019697
UniProt: Q8C6L5 Q8BSY1
LinkDB
Structure
PDB: 

Position
9; 9 E1
AA seq 507 aa
MEDPRRRTTAPRAKKPSAKRAPTQPSRTRAHAESCGPQRGARSRRAERDGDTTEKPRAPG
PRVHPARATELTKDAQPSAMDAAGATARPAVRVPQQQAILDPELPAVREPQPPADPEARK
VVRGPSHRRGARSTGQPRAPRGSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLR
RMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFK
RIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRN
PEEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQG
ETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCS
YHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQEL
IDRKSKEFLSKKIEYERNNGFPIFDKL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggaagatccgcgtagaaggacgacggcgccacgcgctaagaagccgtccgcgaagcgc
gccccgacgcagcccagcaggaccagggcccacgcggaaagctgcggcccgcaaaggggg
gctcgatcgcggcgggcggagcgtgacggggacaccacggagaagccacgtgccccaggg
ccccgagtgcatccagcaagggccactgagctcaccaaagatgcacagccctcggccatg
gacgcggcaggagccaccgcgcggcctgccgtccgggtgccccagcagcaggccatcctg
gatccggagctgcccgccgtacgggagccccagccgcccgcggatcccgaggcgcggaaa
gtcgtaaggggacctagccacagaaggggcgcgcgctccaccgggcagcccagagcgccg
cgagggtccaggaaggaaccggacaagctaaagaaggtgctggacaaattgagattgaaa
cgcaaagatatctcggaggcggccgagacggtgaataaagttgtggaacgcctgctgcgc
agaatgcagaaacgggagtcggagttcaaaggtgtggagcagctgaacactggcagctac
tatgaacatgtgaagatttctgctcctaatgaatttgatgttatgtttaaactggaagtc
cccaggattgagctacaagaatattatgaaacaggtgctttctatcttgtgaaattcaaa
agaattccacgaggaaatccgctgagtcatttcttagaaggggaagtattatcagctacc
aagatgctgtcaaagtttaggaaaatcattaaagaagaagttaaagaaatcaaagatata
gatgtcagtgtggagaaggaaaaaccaggaagccctgctgtaacacttcttatcaggaac
cctgaagaaatctctgtggatataattctggctttggagtcaaaaggcagctggcctatt
agtaccaaagaaggactacctattcaaggctggctgggcacaaaagtgaggaccaatcta
agacgagagccgttttatctcgtacccaagaatgcaaaggatggaaatagttttcaagga
gagacctggcgcctctctttctctcacactgaaaagtacattttgaataatcacgggata
gagaaaacatgctgtgaatcttccggagcaaaatgctgcagaaaagaatgtttaaaatta
atgaaataccttttggaacagttgaaaaaagagtttcaagagctggatgcattctgttcc
taccatgtgaaaactgccatctttcacatgtggacccaggacccgcaggacagtcagtgg
gaccccaggaacctcagctcctgcttcgataagttgttagcattctttcttgagtgcctc
aggacagagaaactggatcattattttattccaaagttcaatctattctctcaagaacta
attgaccgaaaaagtaaagaatttctatcgaagaaaattgaatatgaaagaaataatggg
tttccaatttttgacaagctttga

DBGET integrated database retrieval system