KEGG   Mus musculus (mouse): 21752Help
Entry
21752             CDS       T01002                                 

Gene name
Tert, EST2, TCS1, TP2, TR, TRT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21752 (Tert)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    21752 (Tert)
   05226 Gastric cancer
    21752 (Tert)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21752 (Tert)
   05165 Human papillomavirus infection
    21752 (Tert)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    21752 (Tert)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     21752 (Tert)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    21752 (Tert)
   Telomerase complex (fungi)
    21752 (Tert)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Telomerase_RBD RVT_1
Motif
Other DBs
NCBI-GeneID: 21752
NCBI-ProteinID: NP_033380
MGI: 1202709
Ensembl: ENSMUSG00000021611
UniProt: O70372
LinkDB All DBs
Position
13 C1; 13 40.12 cM
AA seq 1122 aa AA seqDB search
MTRAPRCPAVRSLLRSRYREVWPLATFVRRLGPEGRRLVQPGDPKIYRTLVAQCLVCMHW
GSQPPPADLSFHQVSSLKELVARVVQRLCERNERNVLAFGFELLNEARGGPPMAFTSSVR
SYLPNTVIETLRVSGAWMLLLSRVGDDLLVYLLAHCALYLLVPPSCAYQVCGSPLYQICA
TTDIWPSVSASYRPTRPVGRNFTNLRFLQQIKSSSRQEAPKPLALPSRGTKRHLSLTSTS
VPSAKKARCYPVPRVEEGPHRQVLPTPSGKSWVPSPARSPEVPTAEKDLSSKGKVSDLSL
SGSVCCKHKPSSTSLLSPPRQNAFQLRPFIETRHFLYSRGDGQERLNPSFLLSNLQPNLT
GARRLVEIIFLGSRPRTSGPLCRTHRLSRRYWQMRPLFQQLLVNHAECQYVRLLRSHCRF
RTANQQVTDALNTSPPHLMDLLRLHSSPWQVYGFLRACLCKVVSASLWGTRHNERRFFKN
LKKFISLGKYGKLSLQELMWKMKVEDCHWLRSSPGKDRVPAAEHRLRERILATFLFWLMD
TYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLERVRLRELSQEEVRHHQ
DTWLAMPICRLRFIPKPNGLRPIVNMSYSMGTRALGRRKQAQHFTQRLKTLFSMLNYERT
KHPHLMGSSVLGMNDIYRTWRAFVLRVRALDQTPRMYFVKADVTGAYDAIPQGKLVEVVA
NMIRHSESTYCIRQYAVVRRDSQGQVHKSFRRQVTTLSDLQPYMGQFLKHLQDSDASALR
NSVVIEQSISMNESSSSLFDFFLHFLRHSVVKIGDRCYTQCQGIPQGSSLSTLLCSLCFG
DMENKLFAEVQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNF
PVEPGTLGGAAPYQLPAHCLFPWCGLLLDTQTLEVFCDYSGYAQTSIKTSLTFQSVFKAG
KTMRNKLLSVLRLKCHGLFLDLQVNSLQTVCINIYKIFLLQAYRFHACVIQLPFDQRVRK
NLTFFLGIISSQASCCYAILKVKNPGMTLKASGSFPPEAAHWLCYQAFLLKLAAHSVIYK
CLLGPLRTAQKLLCRKLPEATMTILKAAADPALSTDFQTILD
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgctcctcgttgccccgcggtgcgctctctgctgcgcagccgataccgggag
gtgtggccgctggcaacctttgtgcggcgcctggggcccgagggcaggcggcttgtgcaa
cccggggacccgaagatctaccgcactttggttgcccaatgcctagtgtgcatgcactgg
ggctcacagcctccacctgccgacctttccttccaccaggtgtcatccctgaaagagctg
gtggccagggttgtgcagagactctgcgagcgcaacgagagaaacgtgctggcttttggc
tttgagctgcttaacgaggccagaggcgggcctcccatggccttcactagtagcgtgcgt
agctacttgcccaacactgttattgagaccctgcgtgtcagtggtgcatggatgctactg
ttgagccgagtgggcgacgacctgctggtctacctgctggcacactgtgctctttatctt
ctggtgccccccagctgtgcctaccaggtgtgtgggtctcccctgtaccaaatttgtgcc
accacggatatctggccctctgtgtccgctagttacaggcccacccgacccgtgggcagg
aatttcactaaccttaggttcttacaacagatcaagagcagtagtcgccaggaagcaccg
aaacccctggccttgccatctcgaggtacaaagaggcatctgagtctcaccagtacaagt
gtgccttcagctaagaaggccagatgctatcctgtcccgagagtggaggagggaccccac
aggcaggtgctaccaaccccatcaggcaaatcatgggtgccaagtcctgctcggtccccc
gaggtgcctactgcagagaaagatttgtcttctaaaggaaaggtgtctgacctgagtctc
tctgggtcggtgtgctgtaaacacaagcccagctccacatctctgctgtcaccaccccgc
caaaatgcctttcagctcaggccatttattgagaccagacatttcctttactccagggga
gatggccaagagcgtctaaacccctcattcctactcagcaacctccagcctaacttgact
ggggccaggagactggtggagatcatctttctgggctcaaggcctaggacatcaggacca
ctctgcaggacacaccgtctatcgcgtcgatactggcagatgcggcccctgttccaacag
ctgctggtgaaccatgcagagtgccaatatgtcagactcctcaggtcacattgcaggttt
cgaacagcaaaccaacaggtgacagatgccttgaacaccagcccaccgcacctcatggat
ttgctccgcctgcacagcagtccctggcaggtatatggttttcttcgggcctgtctctgc
aaggtggtgtctgctagtctctggggtaccaggcacaatgagcgccgcttctttaagaac
ttaaagaagttcatctcgttggggaaatacggcaagctatcactgcaggaactgatgtgg
aagatgaaagtagaggattgccactggctccgcagcagcccggggaaggaccgtgtcccc
gctgcagagcaccgtctgagggagaggatcctggctacgttcctgttctggctgatggac
acatacgtggtacagctgcttaggtcattcttttacatcacagagagcacattccagaag
aacaggctcttcttctaccgtaagagtgtgtggagcaagctgcagagcattggagtcagg
caacaccttgagagagtgcggctacgggagctgtcacaagaggaggtcaggcatcaccag
gacacctggctagccatgcccatctgcagactgcgcttcatccccaagcccaacggcctg
cggcccattgtgaacatgagttatagcatgggtaccagagctttgggcagaaggaagcag
gcccagcatttcacccagcgtctcaagactctcttcagcatgctcaactatgagcggaca
aaacatcctcaccttatggggtcttctgtactgggtatgaatgacatctacaggacctgg
cgggcctttgtgctgcgtgtgcgtgctctggaccagacacccaggatgtactttgttaag
gcagatgtgaccggggcctatgatgccatcccccagggtaagctggtggaggttgttgcc
aatatgatcaggcactcggagagcacgtactgtatccgccagtatgcagtggtccggaga
gatagccaaggccaagtccacaagtcctttaggagacaggtcaccaccctctctgacctc
cagccatacatgggccagttccttaagcatctgcaggattcagatgccagtgcactgagg
aactccgttgtcatcgagcagagcatctctatgaatgagagcagcagcagcctgtttgac
ttcttcctgcacttcctgcgtcacagtgtcgtaaagattggtgacaggtgctatacgcag
tgccagggcatcccccagggctccagcctatccaccctgctctgcagtctgtgtttcgga
gacatggagaacaagctgtttgctgaggtgcagcgggatgggttgcttttacgttttgtt
gatgactttctgttggtgacgcctcacttggaccaagcaaaaaccttcctcagcaccctg
gtccatggcgttcctgagtatgggtgcatgataaacttgcagaagacagtggtgaacttc
cctgtggagcctggtaccctgggtggtgcagctccataccagctgcctgctcactgcctg
tttccctggtgtggcttgctgctggacactcagactttggaggtgttctgtgactactca
ggttatgcccagacctcaattaagacgagcctcaccttccagagtgtcttcaaagctggg
aagaccatgcggaacaagctcctgtcggtcttgcggttgaagtgtcacggtctatttcta
gacttgcaggtgaacagcctccagacagtctgcatcaatatatacaagatcttcctgctt
caggcctacaggttccatgcatgtgtgattcagcttccctttgaccagcgtgttaggaag
aacctcacattctttctgggcatcatctccagccaagcatcctgctgctatgctatcctg
aaggtcaagaatccaggaatgacactaaaggcctctggctcctttcctcctgaagccgca
cattggctctgctaccaggccttcctgctcaagctggctgctcattctgtcatctacaaa
tgtctcctgggacctctgaggacagcccaaaaactgctgtgccggaagctcccagaggcg
acaatgaccatccttaaagctgcagctgacccagccctaagcacagactttcagaccatt
ttggactaa

DBGET integrated database retrieval system