KEGG   Mus musculus (mouse): 21803Help
Entry
21803             CDS       T01002                                 

Gene name
Tgfb1, TGF-beta1, TGFbeta1, Tgfb, Tgfb-1
Definition
(RefSeq) transforming growth factor, beta 1
  KO
K13375  transforming growth factor beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04380  Osteoclast differentiation
mmu04390  Hippo signaling pathway
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04926  Relaxin signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21803 (Tgfb1)
   04350 TGF-beta signaling pathway
    21803 (Tgfb1)
   04390 Hippo signaling pathway
    21803 (Tgfb1)
   04068 FoxO signaling pathway
    21803 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21803 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    21803 (Tgfb1)
   04218 Cellular senescence
    21803 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    21803 (Tgfb1)
   04672 Intestinal immune network for IgA production
    21803 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    21803 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    21803 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21803 (Tgfb1)
   05205 Proteoglycans in cancer
    21803 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21803 (Tgfb1)
   05212 Pancreatic cancer
    21803 (Tgfb1)
   05225 Hepatocellular carcinoma
    21803 (Tgfb1)
   05226 Gastric cancer
    21803 (Tgfb1)
   05220 Chronic myeloid leukemia
    21803 (Tgfb1)
   05211 Renal cell carcinoma
    21803 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    21803 (Tgfb1)
   05321 Inflammatory bowel disease (IBD)
    21803 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    21803 (Tgfb1)
   05414 Dilated cardiomyopathy (DCM)
    21803 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    21803 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    21803 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    21803 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21803 (Tgfb1)
   05161 Hepatitis B
    21803 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    21803 (Tgfb1)
   05144 Malaria
    21803 (Tgfb1)
   05145 Toxoplasmosis
    21803 (Tgfb1)
   05140 Leishmaniasis
    21803 (Tgfb1)
   05142 Chagas disease (American trypanosomiasis)
    21803 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    21803 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21803 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21803 (Tgfb1)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   21803 (Tgfb1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   21803 (Tgfb1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   21803 (Tgfb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 21803
NCBI-ProteinID: NP_035707
MGI: 98725
Ensembl: ENSMUSG00000002603
Vega: OTTMUSG00000036027
UniProt: P04202 Q3UNK5
LinkDB All DBs
Position
7 A3; 7 13.98 cM
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAI
YEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWR
YLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctactgccgcttctgctcccactcccgtggcttctagtg
ctgacgcccgggaggccagccgcgggactctccacctgcaagaccatcgacatggagctg
gtgaaacggaagcgcatcgaagccatccgtggccagatcctgtccaaactaaggctcgcc
agtcccccaagccagggggaggtaccgcccggcccgctgcccgaggcggtgctcgctttg
tacaacagcacccgcgaccgggtggcaggcgagagcgccgacccagagccggagcccgaa
gcggactactatgctaaagaggtcacccgcgtgctaatggtggaccgcaacaacgccatc
tatgagaaaaccaaagacatctcacacagtatatatatgttcttcaatacgtcagacatt
cgggaagcagtgcccgaacccccattgctgtcccgtgcagagctgcgcttgcagagatta
aaatcaagtgtggagcaacatgtggaactctaccagaaatatagcaacaattcctggcgt
taccttggtaaccggctgctgacccccactgatacgcctgagtggctgtcttttgacgtc
actggagttgtacggcagtggctgaaccaaggagacggaatacagggctttcgattcagc
gctcactgctcttgtgacagcaaagataacaaactccacgtggaaatcaacgggatcagc
cccaaacgtcggggcgacctgggcaccatccatgacatgaaccggcccttcctgctcctc
atggccacccccctggaaagggcccagcacctgcacagctcacggcaccggagagccctg
gataccaactattgcttcagctccacagagaagaactgctgtgtgcggcagctgtacatt
gactttaggaaggacctgggttggaagtggatccacgagcccaagggctaccatgccaac
ttctgtctgggaccctgcccctatatttggagcctggacacacagtacagcaaggtcctt
gccctctacaaccaacacaacccgggcgcttcggcgtcaccgtgctgcgtgccgcaggct
ttggagccactgcccatcgtctactacgtgggtcgcaagcccaaggtggagcagttgtcc
aacatgattgtgcgctcctgcaagtgcagctga

KEGG   Mus musculus (mouse): 21808Help
Entry
21808             CDS       T01002                                 

Gene name
Tgfb2, BB105277, Tgf-beta2, Tgfb-2
Definition
(RefSeq) transforming growth factor, beta 2
  KO
K13376  transforming growth factor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04380  Osteoclast differentiation
mmu04390  Hippo signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21808 (Tgfb2)
   04350 TGF-beta signaling pathway
    21808 (Tgfb2)
   04390 Hippo signaling pathway
    21808 (Tgfb2)
   04068 FoxO signaling pathway
    21808 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21808 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    21808 (Tgfb2)
   04218 Cellular senescence
    21808 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    21808 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21808 (Tgfb2)
   05206 MicroRNAs in cancer
    21808 (Tgfb2)
   05205 Proteoglycans in cancer
    21808 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21808 (Tgfb2)
   05212 Pancreatic cancer
    21808 (Tgfb2)
   05225 Hepatocellular carcinoma
    21808 (Tgfb2)
   05226 Gastric cancer
    21808 (Tgfb2)
   05220 Chronic myeloid leukemia
    21808 (Tgfb2)
   05211 Renal cell carcinoma
    21808 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    21808 (Tgfb2)
   05321 Inflammatory bowel disease (IBD)
    21808 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    21808 (Tgfb2)
   05414 Dilated cardiomyopathy (DCM)
    21808 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    21808 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    21808 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21808 (Tgfb2)
   05161 Hepatitis B
    21808 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    21808 (Tgfb2)
   05144 Malaria
    21808 (Tgfb2)
   05145 Toxoplasmosis
    21808 (Tgfb2)
   05140 Leishmaniasis
    21808 (Tgfb2)
   05142 Chagas disease (American trypanosomiasis)
    21808 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21808 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21808 (Tgfb2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   21808 (Tgfb2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   21808 (Tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Disaggr_repeat SPEG_u2
Motif
Other DBs
NCBI-GeneID: 21808
NCBI-ProteinID: NP_033393
MGI: 98726
Ensembl: ENSMUSG00000039239
Vega: OTTMUSG00000050852
UniProt: P27090 Q8CDZ9 Q3TWH5
LinkDB All DBs
Structure
PDB: 

Position
1 H5; 1 89.95 cM
AA seq 414 aa AA seqDB search
MHYCVLSTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHLPSENAIPP
TFYRPYFRIVRFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHLLLMLLPSYRLESQQSSRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
TKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcacctttttgctcctgcatctggtcccggtggcgctcagt
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaagactatccggagccg
gatgaggtccccccggaggtgatttccatctacaacagtaccagggacttactgcaggag
aaggcaagccggagggcagccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttataaaatcgacatgccgtcccacctcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaatcgtccgctttgatgtctcaacaatggagaaaaat
gcttcgaatctggtgaaggcagagttcagggtcttccgcttgcaaaaccccaaagccaga
gtggccgagcagcggattgaactgtatcagatccttaaatccaaagacttaacatctccc
acccagcgctacatcgatagcaaggttgtgaaaaccagagcggagggtgaatggctctcc
ttcgacgtgacagacgctgtgcaggagtggcttcaccacaaagacaggaacctggggttt
aaaataagtttacactgcccctgctgtaccttcgtgccgtctaataattacatcatcccg
aataaaagcgaagagctcgaggcgagatttgcaggtattgatggcacctctacatatgcc
agtggtgatcagaaaactataaagtccactaggaaaaaaaccagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagactggagtcacaacagtccagccggcggaag
aagcgcgctttggatgctgcctactgctttagaaatgtgcaggataattgctgccttcgc
cctctttacattgattttaagagggatcttggatggaaatggatccatgaacccaaaggg
tacaatgctaacttctgtgctggggcatgcccatatctatggagttcagacactcaacac
accaaagtcctcagcctgtacaacaccataaatcccgaagcttccgcttccccttgctgt
gtgtcccaggatctggaaccactgaccattctctattacattggaaatacgcccaagatc
gaacagctttccaatatgattgtcaagtcttgtaaatgcagctaa

KEGG   Mus musculus (mouse): 21809Help
Entry
21809             CDS       T01002                                 

Gene name
Tgfb3, TGF-beta-3, Tgfb-3
Definition
(RefSeq) transforming growth factor, beta 3
  KO
K13377  transforming growth factor beta-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21809 (Tgfb3)
   04350 TGF-beta signaling pathway
    21809 (Tgfb3)
   04390 Hippo signaling pathway
    21809 (Tgfb3)
   04068 FoxO signaling pathway
    21809 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21809 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    21809 (Tgfb3)
   04218 Cellular senescence
    21809 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21809 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21809 (Tgfb3)
   05212 Pancreatic cancer
    21809 (Tgfb3)
   05225 Hepatocellular carcinoma
    21809 (Tgfb3)
   05226 Gastric cancer
    21809 (Tgfb3)
   05220 Chronic myeloid leukemia
    21809 (Tgfb3)
   05211 Renal cell carcinoma
    21809 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    21809 (Tgfb3)
   05321 Inflammatory bowel disease (IBD)
    21809 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    21809 (Tgfb3)
   05414 Dilated cardiomyopathy (DCM)
    21809 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    21809 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    21809 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21809 (Tgfb3)
   05161 Hepatitis B
    21809 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    21809 (Tgfb3)
   05144 Malaria
    21809 (Tgfb3)
   05145 Toxoplasmosis
    21809 (Tgfb3)
   05140 Leishmaniasis
    21809 (Tgfb3)
   05142 Chagas disease (American trypanosomiasis)
    21809 (Tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21809 (Tgfb3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   21809 (Tgfb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 21809
NCBI-ProteinID: NP_033394
MGI: 98727
Ensembl: ENSMUSG00000021253
UniProt: Q91YU7 Q3TRQ9
LinkDB All DBs
Position
12 D2; 12 40.09 cM
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNLATISLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQETSESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NVHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGSQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtagtcctggccctgctgaacttggccacaatc
agcctctctctgtccacttgcaccacgttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccatcg
gtgatgacccacgtcccctatcaggtcctggcactttacaacagcacccgggagttgctg
gaagagatgcacggggagagggaggaaggctgcactcaggagacctcggagtctgagtac
tatgccaaagagatccataaattcgacatgatccagggactggcggagcacaatgaactg
gccgtctgccccaaaggaattacctctaaggtttttcgtttcaatgtgtcctcagtggag
aaaaatggaaccaatctgttccgggcagagttccgggtcttgcgggtgcccaaccccagc
tccaagcgcacagagcagagaattgagctcttccagatacttcgaccggatgagcacata
gccaagcagcgctacataggtggcaagaatctgcccacaaggggcaccgctgaatggctg
tctttcgatgtcactgacactgtgcgcgagtggctgttgaggagagagtccaacttgggt
ctggaaatcagcatccactgtccatgtcacacctttcagcccaatggagacatactggaa
aatgttcatgaggtgatggaaatcaaattcaaaggagtggacaatgaagatgaccatggc
cgtggagacctggggcgtctcaagaagcaaaaggatcaccacaacccacacctgatcctc
atgatgatccccccacaccgactggacagcccaggccagggcagtcagaggaagaagagg
gccctggacaccaattactgcttccgcaacctggaggagaactgctgtgtacgccccctt
tatattgacttccggcaggatctaggctggaaatgggtccacgaacctaagggttactat
gccaacttctgctcaggcccttgcccatacctccgcagcgcagacacaacccatagcacg
gtgcttggactatacaacaccctgaacccagaggcgtctgcctcgccatgctgcgtcccc
caggacctggagcccctgaccatcttgtactatgtgggcagaacccccaaggtggagcag
ctgtccaacatggtggtgaagtcgtgtaagtgcagctga

DBGET integrated database retrieval system