KEGG   Mus musculus (mouse): 21816Help
Entry
21816             CDS       T01002                                 

Gene name
Tgm1, 2310004J08Rik, Tgase1
Definition
(RefSeq) transglutaminase 1, K polypeptide
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    21816 (Tgm1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     21816 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF4232
Motif
Other DBs
NCBI-GeneID: 21816
NCBI-ProteinID: NP_001155186
MGI: 98730
Ensembl: ENSMUSG00000022218
UniProt: Q9JLF6 A0A0R4J293
LinkDB All DBs
Position
14; 14 C3
AA seq 815 aa AA seqDB search
MEGPRSDVGRWGRSPWQPPTTPSPEPEPVPEPDRRSRSRRGGGRSFWARCCGCCSCGNRG
DDDWGPEPSGSRSRGTSSRGRDSRGGRRPESRGSGVNAAGDGTIREGMLVVTGVDLLCSR
SDQNRREHHTDEFEYDELIVRRGQPFHMILFLNREYESSDRIALELLIGSNPEVGKGTHV
IIPVGKGGSGGWKAQVTKNNGHNLNLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPFDPRN
EIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDAC
LYILDRRGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNPSAWVGSVEI
LLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGFATRTVTNFNSAHDTDTSLTMDIYFDENM
KPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESVK
NGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIHSNNREDIT
HIYKHPEGSEAERRAVEKAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLAVSVVLT
NRGSSRRTVKLHLYLCVTYYTGVSGPTFKEAKKEVTLAPGASDSVTMPVAYKEYKPHLVD
QGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECGVQIVFKNPLPVTL
TNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGV
IQVDVAPASGGSGFSDAGGDSRSGENIPMAYRGGA
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtcctcgctcagacgtgggccgctggggcaggagcccctggcagccccctaca
acaccgtcaccggagccagagccggtgccggagccagacagacgctcgcgctcccgccga
ggaggaggccgctccttctgggctcgttgttgtggctgctgctcatgtgggaacagaggg
gacgatgactggggacctgaaccttctggctccagaagcagagggaccagctcccggggt
agggactctcggggtggccgaagacccgagtctcggggcagtggtgtaaatgcagctgga
gatggcaccatccgagagggaatgctggttgtgactggtgtggatctgctgtgctcacga
tcagaccagaaccgccgagagcaccacacggatgagtttgaatatgatgagctgattgtg
cgccgtgggcagcccttccacatgatccttttcttgaaccgggaatatgagtcctctgat
cgcattgcccttgagctcctcattggaagcaatccggaggtgggcaagggcacccacgtg
atcatcccagtgggtaagggaggcagtggtggctggaaggcccaagtgactaagaacaac
ggacacaacctaaacctacgcgtccacacctcccccaatgccatcattggcaagtttcag
ttcactgtccgcacccgctctgaagctggagagttccagttgccctttgacccccgcaat
gagatctacatcctcttcaatccctggtgcccagaggacatagtgtatgtggaccatgag
gactggcggcaagaatatgtgcttaatgagtctggaagaatctactatggaacagaagca
cagattggcgaacgaacctggaactatggtcagtttgaccatggggtgctggatgcctgc
ctgtacatcctggatcggagggggatgccatatggaggtcgtggggacccagtcagtgtc
tctcgggttgtctctgccatggtgaactccctggatgacaatggagttctgattgggaac
tggaccggtgactactctcgaggcaccaacccctcagcgtgggtgggcagtgtggagatc
ctgctcagctacctacgcaccggctattccgtcccctacggccaatgctgggtctttgcc
ggtgtgaccaccacagtgctccgatgtctgggcttcgctacccgtaccgtcaccaacttc
aactctgcacacgacacagacacctccctcactatggacatctactttgatgagaacatg
aagccacttgaacatctgaaccatgattctgtttggaacttccacgtgtggaacgactgc
tggatgaagaggccagatctgccctcaggctttgatgggtggcaggttgtggatgccaca
ccccaggagaccagcagtggcatcttctgctgtggcccctgttctgtggagtccgtcaag
aatggcttagtctacatgaagtatgacacacctttcatttttgctgaggtaaatagcgat
aaggtatactggcagcggcaggatgatggcagctttaagatagtgtacgtggaagagaaa
gccattggcacactcattgtcacaaaggcgatccactccaacaatcgagaggacatcacc
cacatctataagcacccagaaggctcagaagcagagcggagggctgtggagaaggcggca
gcccatggcagcaaacctaatgtgtatgccacccgggactccgctgaggatgtggcaatg
caggtggaggcgcaggacgctgtgatggggcaggatctggctgtctctgtggtgctgacc
aatcgtggtagtagccgacgcactgtgaagttgcacctctacctttgtgtcacctactac
actggtgtctctgggcctaccttcaaggaggccaaaaaggaagtgacattagccccagga
gcctcggactctgtgaccatgcctgtggcctacaaggaatacaagccccaccttgtggac
cagggggcaatgttgctcaatgtctcaggccatgtcaaggagagtgggcaggtactagcc
aagcaacacaccttccgtttgcgcaccccagacctttctcttacgttactgggagcagca
gttgttggtcaggaatgtggagtacagatcgtgttcaagaaccccctgcctgtcaccctc
accaacgtcgtcttccggctcgaaggttctggattacagagacccaaggtcctcaatgtc
ggggacatcgggggtaatgagacagtcacactgcgccagacgtttgttcccgtgcgacca
ggcccccgccagctcattgccagcctggacagtccacagctttcccaagtgcacggtgtt
attcaagtggatgtggccccagcctctggaggcagcggtttctcagatgctggaggtgac
agtcgctctggggagaacatacctatggcatatcgaggtggagcttaa

DBGET integrated database retrieval system