KEGG   Mus musculus (mouse): 21898Help
Entry
21898             CDS       T01002                                 

Gene name
Tlr4, Lps, Ly87, Ran/M1, Rasl2-8
Definition
(RefSeq) toll-like receptor 4
  KO
K10160  toll-like receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21898 (Tlr4)
   04066 HIF-1 signaling pathway
    21898 (Tlr4)
   04151 PI3K-Akt signaling pathway
    21898 (Tlr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21898 (Tlr4)
  09143 Cell growth and death
   04217 Necroptosis
    21898 (Tlr4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    21898 (Tlr4)
   04621 NOD-like receptor signaling pathway
    21898 (Tlr4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    21898 (Tlr4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    21898 (Tlr4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    21898 (Tlr4)
   05321 Inflammatory bowel disease (IBD)
    21898 (Tlr4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    21898 (Tlr4)
   05135 Yersinia infection
    21898 (Tlr4)
   05133 Pertussis
    21898 (Tlr4)
   05134 Legionellosis
    21898 (Tlr4)
   05152 Tuberculosis
    21898 (Tlr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21898 (Tlr4)
   05162 Measles
    21898 (Tlr4)
   05164 Influenza A
    21898 (Tlr4)
   05161 Hepatitis B
    21898 (Tlr4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    21898 (Tlr4)
   05144 Malaria
    21898 (Tlr4)
   05145 Toxoplasmosis
    21898 (Tlr4)
   05140 Leishmaniasis
    21898 (Tlr4)
   05142 Chagas disease (American trypanosomiasis)
    21898 (Tlr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21898 (Tlr4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    21898 (Tlr4)
   04090 CD molecules [BR:mmu04090]
    21898 (Tlr4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21898 (Tlr4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    21898 (Tlr4)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   21898 (Tlr4)
CD molecules [BR:mmu04090]
 Proteins
  21898 (Tlr4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   21898 (Tlr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 DUF1863 LRR_9
Motif
Other DBs
NCBI-GeneID: 21898
NCBI-ProteinID: NP_067272
MGI: 96824
Ensembl: ENSMUSG00000039005
Vega: OTTMUSG00000000227
UniProt: Q9QUK6 L0CL36
LinkDB All DBs
Structure
PDB: 

Position
4 C1; 4 34.66 cM
AA seq 835 aa AA seqDB search
MMPPWLLARTLIMALFFSCLTPGSLNPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDL
SFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGS
FSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVD
LSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSN
IMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIV
KFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNK
GSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLE
ELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNS
FKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQ
LYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQKFLQWVKEQKQFLVN
VEQMTCATPVEMNTSLVLDFNNSTCYMYKTIISVSVVSVIVVSTVAFLIYHFYFHLILIA
GCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQ
VELYRLLSRNTYLEWEDNPLGRHIFWRRLKNALLDGKASNPEQTAEEEQETATWT
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctccctggctcctggctaggactctgatcatggcactgttcttctcctgcctg
acaccaggaagcttgaatccctgcatagaggtagttcctaatattacctaccaatgcatg
gatcagaaactcagcaaagtccctgatgacattccttcttcaaccaagaacatagatctg
agcttcaaccccttgaagatcttaaaaagctatagcttctccaatttttcagaacttcag
tggctggatttatccaggtgtgaaattgaaacaattgaagacaaggcatggcatggctta
caccacctctcaaacttgatactgacaggaaaccctatccagagtttttccccaggaagt
ttctctggactaacaagtttagagaatctggtggctgtggagacaaaattggcctctcta
gaaagcttccctattggacagcttataaccttaaagaaactcaatgtggctcacaatttt
atacattcctgtaagttacctgcatatttttccaatctgacgaacctagtacatgtggat
ctttcttataactatattcaaactattactgtcaacgacttacagtttctacgtgaaaat
ccacaagtcaatctctctttagacatgtctttgaacccaattgacttcattcaagaccaa
gcctttcagggaattaagctccatgaactgactctaagaggtaattttaatagctcaaat
ataatgaaaacttgccttcaaaacctggctggtttacacgtccatcggttgatcttggga
gaatttaaagatgaaaggaatctggaaatttttgaaccctctatcatggaaggactatgt
gatgtgaccattgatgagttcaggttaacatatacaaatgatttttcagatgatattgtt
aagttccattgcttggcgaatgtttctgcaatgtctctggcaggtgtatctataaaatat
ctagaagatgttcctaaacatttcaaatggcaatccttatcaatcattagatgtcaactt
aagcagtttccaactctggatctaccctttcttaaaagtttgactttaactatgaacaaa
gggtctatcagttttaaaaaagtggccctaccaagtctcagctatctagatcttagtaga
aatgcactgagctttagtggttgctgttcttattctgatttgggaacaaacagcctgaga
cacttagacctcagcttcaatggtgccatcattatgagtgccaatttcatgggtctagaa
gagctgcagcacctggattttcagcactctactttaaaaagggtcacagaattctcagcg
ttcttatcccttgaaaagctactttaccttgacatctcttatactaacaccaaaattgac
ttcgatggtatatttcttggcttgaccagtctcaacacattaaaaatggctggcaattct
ttcaaagacaacaccctttcaaatgtctttgcaaacacaacaaacttgacattcctggat
ctttctaaatgtcaattggaacaaatatcttggggggtatttgacaccctccatagactt
caattattaaatatgagtcacaacaatctattgtttttggattcatcccattataaccag
ctgtattccctcagcactcttgattgcagtttcaatcgcatagagacatctaaaggaata
ctgcaacattttccaaagagtctagccttcttcaatcttactaacaattctgttgcttgt
atatgtgaacatcagaaattcctgcagtgggtcaaggaacagaagcagttcttggtgaat
gttgaacaaatgacatgtgcaacacctgtagagatgaatacctccttagtgttggatttt
aataattctacctgttatatgtacaagacaatcatcagtgtgtcagtggtcagtgtgatt
gtggtatccactgtagcatttctgatataccacttctattttcacctgatacttattgct
ggctgtaaaaagtacagcagaggagaaagcatctatgatgcatttgtgatctactcgagt
cagaatgaggactgggtgagaaatgagctggtaaagaatttagaagaaggagtgccccgc
tttcacctctgccttcactacagagactttattcctggtgtagccattgctgccaacatc
atccaggaaggcttccacaagagccggaaggttattgtggtagtgtctagacactttatt
cagagccgttggtgtatctttgaatatgagattgctcaaacatggcagtttctgagcagc
cgctctggcatcatcttcattgtccttgagaaggttgagaagtccctgctgaggcagcag
gtggaattgtatcgccttcttagcagaaacacctacctggaatgggaggacaatcctctg
gggaggcacatcttctggagaagacttaaaaatgccctattggatggaaaagcctcgaat
cctgagcaaacagcagaggaagaacaagaaacggcaacttggacctga

DBGET integrated database retrieval system