KEGG   Mus musculus (mouse): 21926Help
Entry
21926             CDS       T01002                                 

Gene name
Tnf, DIF, TNF-a, TNF-alpha, TNFSF2, TNFalpha, Tnfa, Tnfsf1a, Tnlg1f
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04064  NF-kappa B signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04150  mTOR signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04350  TGF-beta signaling pathway
mmu04380  Osteoclast differentiation
mmu04612  Antigen processing and presentation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04650  Natural killer cell mediated cytotoxicity
mmu04657  IL-17 signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04940  Type I diabetes mellitus
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05310  Asthma
mmu05321  Inflammatory bowel disease (IBD)
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21926 (Tnf)
   04350 TGF-beta signaling pathway
    21926 (Tnf)
   04064 NF-kappa B signaling pathway
    21926 (Tnf)
   04668 TNF signaling pathway
    21926 (Tnf)
   04071 Sphingolipid signaling pathway
    21926 (Tnf)
   04150 mTOR signaling pathway
    21926 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21926 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    21926 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    21926 (Tnf)
   04217 Necroptosis
    21926 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    21926 (Tnf)
   04620 Toll-like receptor signaling pathway
    21926 (Tnf)
   04621 NOD-like receptor signaling pathway
    21926 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    21926 (Tnf)
   04625 C-type lectin receptor signaling pathway
    21926 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    21926 (Tnf)
   04612 Antigen processing and presentation
    21926 (Tnf)
   04660 T cell receptor signaling pathway
    21926 (Tnf)
   04657 IL-17 signaling pathway
    21926 (Tnf)
   04664 Fc epsilon RI signaling pathway
    21926 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    21926 (Tnf)
  09158 Development
   04380 Osteoclast differentiation
    21926 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    21926 (Tnf)
  09163 Immune disease
   05310 Asthma
    21926 (Tnf)
   05322 Systemic lupus erythematosus
    21926 (Tnf)
   05323 Rheumatoid arthritis
    21926 (Tnf)
   05321 Inflammatory bowel disease (IBD)
    21926 (Tnf)
   05330 Allograft rejection
    21926 (Tnf)
   05332 Graft-versus-host disease
    21926 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    21926 (Tnf)
   05014 Amyotrophic lateral sclerosis (ALS)
    21926 (Tnf)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    21926 (Tnf)
   05410 Hypertrophic cardiomyopathy (HCM)
    21926 (Tnf)
   05414 Dilated cardiomyopathy (DCM)
    21926 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    21926 (Tnf)
   04940 Type I diabetes mellitus
    21926 (Tnf)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    21926 (Tnf)
   04931 Insulin resistance
    21926 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    21926 (Tnf)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    21926 (Tnf)
   05133 Pertussis
    21926 (Tnf)
   05134 Legionellosis
    21926 (Tnf)
   05152 Tuberculosis
    21926 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21926 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    21926 (Tnf)
   05164 Influenza A
    21926 (Tnf)
   05161 Hepatitis B
    21926 (Tnf)
   05160 Hepatitis C
    21926 (Tnf)
   05168 Herpes simplex virus 1 infection
    21926 (Tnf)
   05163 Human cytomegalovirus infection
    21926 (Tnf)
   05169 Epstein-Barr virus infection
    21926 (Tnf)
   05165 Human papillomavirus infection
    21926 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    21926 (Tnf)
   05144 Malaria
    21926 (Tnf)
   05145 Toxoplasmosis
    21926 (Tnf)
   05140 Leishmaniasis
    21926 (Tnf)
   05142 Chagas disease (American trypanosomiasis)
    21926 (Tnf)
   05143 African trypanosomiasis
    21926 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    21926 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21926 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21926 (Tnf)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   21926 (Tnf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines
   21926 (Tnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF DUF956
Motif
Other DBs
NCBI-GeneID: 21926
NCBI-ProteinID: NP_038721
MGI: 104798
Ensembl: ENSMUSG00000024401
Vega: OTTMUSG00000037196
UniProt: P06804 Q3U593
LinkDB All DBs
Structure
PDB: 

Position
17 B1; 17 18.59 cM
AA seq 235 aa AA seqDB search
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCP
KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaagcatgatccgcgacgtggaactggcagaagaggcactcccccaaaag
atggggggcttccagaactccaggcggtgcctatgtctcagcctcttctcattcctgctt
gtggcaggggccaccacgctcttctgtctactgaacttcggggtgatcggtccccaaagg
gatgagaagttcccaaatggcctccctctcatcagttctatggcccagaccctcacactc
agatcatcttctcaaaattcgagtgacaagcctgtagcccacgtcgtagcaaaccaccaa
gtggaggagcagctggagtggctgagccagcgcgccaacgccctcctggccaacggcatg
gatctcaaagacaaccaactagtggtgccagccgatgggttgtaccttgtctactcccag
gttctcttcaagggacaaggctgccccgactacgtgctcctcacccacaccgtcagccga
tttgctatctcataccaggagaaagtcaacctcctctctgccgtcaagagcccctgcccc
aaggacacccctgagggggctgagctcaaaccctggtatgagcccatatacctgggagga
gtcttccagctggagaagggggaccaactcagcgctgaggtcaatctgcccaagtactta
gactttgcggagtccgggcaggtctactttggagtcattgctctgtga

DBGET integrated database retrieval system