KEGG   Mus musculus (mouse): 21929Help
Entry
21929             CDS       T01002                                 

Gene name
Tnfaip3, A20, Tnfip3
Definition
(RefSeq) tumor necrosis factor, alpha-induced protein 3
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05162  Measles
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21929 (Tnfaip3)
   04668 TNF signaling pathway
    21929 (Tnfaip3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    21929 (Tnfaip3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    21929 (Tnfaip3)
   04657 IL-17 signaling pathway
    21929 (Tnfaip3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    21929 (Tnfaip3)
   05169 Epstein-Barr virus infection
    21929 (Tnfaip3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    21929 (Tnfaip3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    21929 (Tnfaip3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     21929 (Tnfaip3)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C64
   21929 (Tnfaip3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    21929 (Tnfaip3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-A20 OTU
Motif
Other DBs
NCBI-GeneID: 21929
NCBI-ProteinID: NP_033423
MGI: 1196377
Ensembl: ENSMUSG00000019850
Vega: OTTMUSG00000018149
UniProt: Q60769 Q7TQD1
LinkDB All DBs
Structure
PDB: 

Position
10 A3; 10 8.08 cM
AA seq 775 aa AA seqDB search
MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDL
VLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTP
AARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
DQARRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKLPK
LNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPSLFLFSETTAMKCRSPGCPFTLN
VQHNGFCERCHARQINASHTADPGKCQACLQDVTRTFNGICSTCFKRTTAEPSSSLTSSI
PASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCLSQAARTPGDRAGTSKCRKAGCMYF
GTPENKGFCTLCFIEYRENKQSVTASEKAGSPAPRFQNNVPCLGRECGTLGSTMFEGYCQ
KCFIEAQNQRFHEARRTEEQLRSSQHRDMPRTTQVASRLKCARASCKNILACRSEELCME
CQHLSQRVGSVAHRGEPTPEEPPKQRCRAPACDHFGNAKCNGYCNECYQFKQMYG
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaacttcttcctcaggctttgtatttgagcaatatgcggaaagctgtgaag
atacgagagagaaccccagaagacattttcaaacctaccaatgggatcatctatcacttt
aaaaccatgcaccgatacacgctggagatgttcagaacatgccagttttgcccacagttc
cgagagatcatccacaaagcacttattgacagaagtgtccaggcttccctggaaagccag
aagaagctcaactggtgtcgtgaagtcaggaagctcgtggctctgaaaaccaatggtgat
ggaaactgcctcatgcatgcagcttgtcagtacatgtggggtgttcaggatactgacctg
gtcctgaggaaggccctctgcagcacccttaaggagacagacactcggaactttaaattc
cgctggcagctggaatctctgaaatctcaggaatttgtggaaacaggactttgctacgac
actcggaactggaatgacgaatgggacaacttggtcaaaatggcatcagcagacacacct
gcagcccgaagtggacttcagtacaattccctggaagaaatccacatatttgtcctcagc
aacatcctcagaagacccatcattgtcatttcagacaaaatgctaagaagtttggaatct
ggttccaattttgctcctttgaaagtgggtgggatttatctgcctcttcactggcctgcc
caggagtgttacagatatcccatcgtcctaggctatgacagccagcactttgtacccctg
gtgaccctgaaggacagtggacctgaacttcgcgctgttccacttgttaacagagaccgg
ggtaggtttgaagacttaaaagttcacttcttgacagatcctgagaatgagatgaaggaa
aagcttctaaaggagtacttgatagtgatggagatccctgtgcaaggctgggaccacggc
acgactcacctgatcaacgctgcaaaattggatgaagctaacttacccaaagaaataaat
ttggtagacgattactttgagcttgttcagcacgaatacaagaaatggcaggagaacagc
gatcaggccaggagagcggcacatgcgcagaaccccttggagccttccacaccccagcta
tcactcatggatataaaatgtgagacacccaactgtcctttcttcatgtccgtgaacact
cagcctttatgccacgaatgctcagagaggcgccaaaagaatcagagcaagctcccaaag
ctgaactcgaagctaggccctgaaggactcccaggcgtgggacttggctcctcaaactgg
agccccgaggaaaccgctggaggacctcattcagccccacccacagcacccagccttttt
ctcttcagtgagaccactgcaatgaagtgcaggagtcctgggtgcccttttactttgaat
gtgcagcataatggattctgtgagcgttgccacgcccggcagattaatgccagccacacc
gcagaccctggaaagtgccaagcctgccttcaggatgtcactcggacctttaatggcatc
tgcagtacctgtttcaaaaggactacagcagagcccagctccagcctcacttccagtatc
cctgcctcctgtcaccaacgctccaagtctgacccctcacaactcatccaaagtctcact
ccacactcttgccaccggactggaaatgtctctccttctggctgcctctcccaggctgca
cggactccaggagacagagcagggacaagcaagtgcaggaaagctggctgcatgtatttt
gggactccagaaaacaagggcttttgcactctatgtttcatcgaatacagagaaaataag
cagtctgttactgcctctgagaaagctggttccccggcccccaggttccagaacaatgtc
ccgtgcctgggcagggagtgcggcacactcggaagcaccatgtttgaagggtactgtcag
aagtgtttcatcgaagctcagaaccagagattccatgaagcaagaagaacggaagaacag
ctgagatcaagccagcatagagacatgcctcgaactacacaggtagcctcaaggctgaaa
tgtgcccgggcctcctgcaagaacattctggcctgtcgcagtgaggaactctgtatggag
tgccagcacctaagccaacgagtaggttctgtggcccaccggggtgagcccacgcctgaa
gagccccctaaacagcgctgccgggcccctgcttgtgatcactttggcaatgccaagtgt
aatggttactgcaatgagtgctaccagttcaagcagatgtatggctaa

DBGET integrated database retrieval system