KEGG   Mus musculus (mouse): 21934Help
Entry
21934             CDS       T01002                                 

Gene name
Tnfrsf11a, Ly109, ODFR, OFE, Rank, TRANCE-R, mRANK
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 11a, NFKB activator
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04917  Prolactin signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21934 (Tnfrsf11a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21934 (Tnfrsf11a)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    21934 (Tnfrsf11a)
  09158 Development
   04380 Osteoclast differentiation
    21934 (Tnfrsf11a)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    21934 (Tnfrsf11a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21934 (Tnfrsf11a)
   04090 CD molecules [BR:mmu04090]
    21934 (Tnfrsf11a)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21934 (Tnfrsf11a)
CD molecules [BR:mmu04090]
 Proteins
  21934 (Tnfrsf11a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RANK_CRD_2 TNFR_c6 Chordopox_A13L
Motif
Other DBs
NCBI-GeneID: 21934
NCBI-ProteinID: NP_033425
MGI: 1314891
Ensembl: ENSMUSG00000026321
Vega: OTTMUSG00000048968
UniProt: O35305
LinkDB All DBs
Structure
PDB: 

Position
1; 1 E2.1
AA seq 625 aa AA seqDB search
MAPRARRRRQLPAPLLALCVLLVPLQVTLQVTPPCTQERHYEHLGRCCSRCEPGKYLSSK
CTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYH
WNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLG
KLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSLIVLLLFISVVVVAAIIFGVYYRKGG
KALTANLWNWVNDACSSLSGNKESSGDRCAGSHSATSSQQEVCEGILLMTREEKMVPEDG
AGVCGPVCAAGGPWAEVRDSRTFTLVSEVETQGDLSRKIPTEDEYTDRPSQPSTGSLLLI
QQGSKSIPPFQEPLEVGENDSLSQCFTGTESTVDSEGCDFTEPPSRTDSMPVSPEKHLTK
EIEGDSCLPWVVSSNSTDGYTGSGNTPGEDHEPFPGSLKCGPLPQCAYSMGFPSEAAASM
AEAGVRPQDRADERGASGSGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVS
QTSQEGPGSAEPESEPVGRPVQEETLAHRDSFAGTAPRFPDVCATGAGLQEQGAPRQKDG
TSRPVQEQGGAQTSLHTQGSGQCAE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcgcccggcggcgccgccagctgcccgcgccgctgctggcgctctgcgtg
ctgctcgttccactgcaggtgactctccaggtcactcctccatgcacccaggagaggcat
tatgagcatctcggacggtgttgcagcagatgcgaaccaggaaagtacctgtcctctaag
tgcactcctacctccgacagtgtgtgtctgccctgtggccccgatgagtacttggacacc
tggaatgaagaagataaatgcttgctgcataaagtctgtgatgcaggcaaggccctggtg
gcggtggatcctggcaaccacacggccccgcgtcgctgtgcttgcacggctggctaccac
tggaactcagactgcgagtgctgccgcaggaacacggagtgtgcacctggcttcggagct
cagcatcccttgcagctcaacaaggatacggtgtgcacaccctgcctcctgggcttcttc
tcagatgtcttttcgtccacagacaaatgcaaaccttggaccaactgcaccctccttgga
aagctagaagcacaccaggggacaacggaatcagatgtggtctgcagctcttccatgaca
ctgaggagaccacccaaggaggcccaggcttacctgcccagtctcatcgttctgctcctc
ttcatctctgtggtagtagtggctgccatcatcttcggcgtttactacaggaagggaggg
aaagcgctgacagctaatttgtggaattgggtcaatgatgcttgcagtagtctaagtgga
aataaggagtcctcaggggaccgttgtgctggttcccactcggcaacctccagtcagcaa
gaagtgtgtgaaggtatcttactaatgactcgggaggagaagatggttccagaagacggt
gctggagtctgtgggcctgtgtgtgcggcaggtgggccctgggcagaagtcagagattct
aggacgttcacactggtcagcgaggttgagacgcaaggagacctctcgaggaagattccc
acagaggatgagtacacggaccggccctcgcagccttcgactggttcactgctcctaatc
cagcagggaagcaaatctatacccccattccaggagcccctggaagtgggggagaacgac
agtttaagccagtgtttcaccgggactgaaagcacggtggattctgagggctgtgacttc
actgagcctccgagcagaactgactctatgcccgtgtcccctgaaaagcacctgacaaaa
gaaatagaaggtgacagttgcctcccctgggtggtcagctccaactcaacagatggctac
acaggcagtgggaacactcctggggaggaccatgaaccctttccagggtccctgaaatgt
ggaccattgccccagtgtgcctacagcatgggctttcccagtgaagcagcagccagcatg
gcagaggcgggagtacggccccaggacagggctgatgagaggggagcctcagggtccggg
agctcccccagtgaccagccacctgcctctgggaacgtgactggaaacagtaactccacg
ttcatctctagcgggcaggtgatgaacttcaagggtgacatcatcgtggtgtatgtcagc
cagacctcgcaggagggcccgggttccgcagagcccgagtcggagcccgtgggccgccct
gtgcaggaggagacgctggcacacagagactcctttgcgggcaccgcgccgcgcttcccc
gacgtctgtgccaccggggctgggctgcaggagcagggggcaccccggcagaaggacggg
acatcgcggccggtgcaggagcagggtggggcgcagacttcactccatacccaggggtcc
ggacaatgtgcagaatga

DBGET integrated database retrieval system