KEGG   Mus musculus (mouse): 21939Help
Entry
21939             CDS       T01002                                 

Gene name
Cd40, AI326936, Bp50, GP39, HIGM1, IGM, IMD3, T-BAM, TRAP, Tnfrsf5, p50
Definition
(RefSeq) CD40 antigen
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04620  Toll-like receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05202  Transcriptional misregulation in cancer
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05330  Allograft rejection
mmu05340  Primary immunodeficiency
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21939 (Cd40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21939 (Cd40)
   04514 Cell adhesion molecules (CAMs)
    21939 (Cd40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    21939 (Cd40)
   04672 Intestinal immune network for IgA production
    21939 (Cd40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    21939 (Cd40)
  09163 Immune disease
   05310 Asthma
    21939 (Cd40)
   05322 Systemic lupus erythematosus
    21939 (Cd40)
   05320 Autoimmune thyroid disease
    21939 (Cd40)
   05330 Allograft rejection
    21939 (Cd40)
   05340 Primary immunodeficiency
    21939 (Cd40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    21939 (Cd40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21939 (Cd40)
   05169 Epstein-Barr virus infection
    21939 (Cd40)
  09174 Infectious disease: parasitic
   05144 Malaria
    21939 (Cd40)
   05145 Toxoplasmosis
    21939 (Cd40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21939 (Cd40)
   04090 CD molecules [BR:mmu04090]
    21939 (Cd40)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21939 (Cd40)
CD molecules [BR:mmu04090]
 Proteins
  21939 (Cd40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 DUF3981
Motif
Other DBs
NCBI-GeneID: 21939
NCBI-ProteinID: NP_035741
MGI: 88336
Ensembl: ENSMUSG00000017652
Vega: OTTMUSG00000016424
UniProt: P27512
LinkDB All DBs
Position
2 H3; 2 85.38 cM
AA seq 289 aa AA seqDB search
MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCH
PCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACA
QHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTS
QTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEM
EDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctttgcctcggctgtgcgcgctatggggctgcttgttgacagcggtccatcta
gggcagtgtgttacgtgcagtgacaaacagtacctccacgatggccagtgctgtgatttg
tgccagccaggaagccgactgacaagccactgcacagctcttgagaagacccaatgccac
ccatgtgactcaggcgaattctcagcccagtggaacagggagattcgctgtcaccagcac
agacactgtgaacccaatcaagggcttcgggttaagaaggagggcaccgcagaatcagac
actgtctgtacctgtaaggaaggacaacactgcaccagcaaggattgcgaggcatgtgct
cagcacacgccctgtatccctggctttggagttatggagatggccactgagaccactgat
accgtctgtcatccctgcccagtcggcttcttctccaatcagtcatcacttttcgaaaag
tgttatccctggacaagctgtgaggataagaacttggaggtcctacagaaaggaacgagt
cagactaatgtcatctgtggtttaaagtcccggatgcgagccctgctggtcattcctgtc
gtgatgggcatcctcatcaccattttcggggtgtttctctatatcaaaaaggtggtcaag
aaaccaaaggataatgagatcttaccccctgcggctcgacggcaagatccccaggagatg
gaagattatcccggtcataacaccgctgctccagtgcaggagacgctgcacgggtgtcag
cctgtcacacaggaggatggtaaagagagtcgcatctcagtgcaggagcggcaggtgaca
gacagcatagccttgaggcccctggtctga

DBGET integrated database retrieval system