KEGG   Mus musculus (mouse): 21947Help
Entry
21947             CDS       T01002                                 

Gene name
Cd40lg, CD154, CD40-L, Cd40l, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, TRAP, Tnfsf5, Tnlg8b, gp39
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05330  Allograft rejection
mmu05340  Primary immunodeficiency
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21947 (Cd40lg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21947 (Cd40lg)
   04514 Cell adhesion molecules (CAMs)
    21947 (Cd40lg)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    21947 (Cd40lg)
   04672 Intestinal immune network for IgA production
    21947 (Cd40lg)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    21947 (Cd40lg)
   05322 Systemic lupus erythematosus
    21947 (Cd40lg)
   05320 Autoimmune thyroid disease
    21947 (Cd40lg)
   05330 Allograft rejection
    21947 (Cd40lg)
   05340 Primary immunodeficiency
    21947 (Cd40lg)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    21947 (Cd40lg)
  09174 Infectious disease: parasitic
   05144 Malaria
    21947 (Cd40lg)
   05145 Toxoplasmosis
    21947 (Cd40lg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21947 (Cd40lg)
   04090 CD molecules [BR:mmu04090]
    21947 (Cd40lg)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   21947 (Cd40lg)
CD molecules [BR:mmu04090]
 Proteins
  21947 (Cd40lg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 21947
NCBI-ProteinID: NP_035746
MGI: 88337
Ensembl: ENSMUSG00000031132
Vega: OTTMUSG00000017791
UniProt: P27548 Q0VEI3
LinkDB All DBs
Position
X A6; X 31.21 cM
AA seq 260 aa AA seqDB search
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLH
EDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNR
EPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNV
TEASQVIHRVGFSSFGLLKL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaacatacagccaaccttcccccagatccgtggcaactggacttccagcgagc
atgaagatttttatgtatttacttactgttttccttatcacccaaatgattggatctgtg
ctttttgctgtgtatcttcatagaagattggataaggtcgaagaggaagtaaaccttcat
gaagattttgtattcataaaaaagctaaagagatgcaacaaaggagaaggatctttatcc
ttgctgaactgtgaggagatgagaaggcaatttgaagaccttgtcaaggatataacgtta
aacaaagaagagaaaaaagaaaacagctttgaaatgcaaagaggtgatgaggatcctcaa
attgcagcacacgttgtaagcgaagccaacagtaatgcagcatccgttctacagtgggcc
aagaaaggatattataccatgaaaagcaacttggtaatgcttgaaaatgggaaacagctg
acggttaaaagagaaggactctattatgtctacactcaagtcaccttctgctctaatcgg
gagccttcgagtcaacgcccattcatcgtcggcctctggctgaagcccagcagtggatct
gagagaatcttactcaaggcggcaaatacccacagttcctcccagctttgcgagcagcag
tctgttcacttgggcggagtgtttgaattacaagctggtgcttctgtgtttgtcaacgtg
actgaagcaagccaagtgatccacagagttggcttctcatcttttggcttactcaaactc
tga

DBGET integrated database retrieval system