KEGG   Mus musculus (mouse): 22030Help
Entry
22030             CDS       T01002                                 

Gene name
Traf2, AI325259
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05135  Yersinia infection
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22030 (Traf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22030 (Traf2)
   04064 NF-kappa B signaling pathway
    22030 (Traf2)
   04668 TNF signaling pathway
    22030 (Traf2)
   04071 Sphingolipid signaling pathway
    22030 (Traf2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    22030 (Traf2)
   04217 Necroptosis
    22030 (Traf2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22030 (Traf2)
   04622 RIG-I-like receptor signaling pathway
    22030 (Traf2)
   04657 IL-17 signaling pathway
    22030 (Traf2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    22030 (Traf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    22030 (Traf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22030 (Traf2)
   05203 Viral carcinogenesis
    22030 (Traf2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22030 (Traf2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    22030 (Traf2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22030 (Traf2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    22030 (Traf2)
   05160 Hepatitis C
    22030 (Traf2)
   05168 Herpes simplex virus 1 infection
    22030 (Traf2)
   05163 Human cytomegalovirus infection
    22030 (Traf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22030 (Traf2)
   05169 Epstein-Barr virus infection
    22030 (Traf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    22030 (Traf2)
   04121 Ubiquitin system [BR:mmu04121]
    22030 (Traf2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22030 (Traf2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     22030 (Traf2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    22030 (Traf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 MATH Cep57_CLD DUF1664
Motif
Other DBs
NCBI-GeneID: 22030
NCBI-ProteinID: NP_033448
MGI: 101835
Ensembl: ENSMUSG00000026942
Vega: OTTMUSG00000012123
UniProt: P39429 Q3U8L1 Q8C6X9
LinkDB All DBs
Position
2; 2 A3
AA seq 501 aa AA seqDB search
MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTS
ILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKE
YESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYE
VCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRL
REHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTA
EACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISD
FTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDA
LLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagtgtgacttcccctggctccctagaactgctacagcctggcttctcc
aagaccctcctggggaccaggttagaagccaagtacctctgttcagcctgcaaaaacatc
ctgcggaggcctttccaggcccagtgtgggcaccgctactgctccttctgcctgaccagc
atcctcagctctgggccccagaactgtgctgcctgtgtctatgaaggcctgtatgaagaa
ggcatttctattttagagagtagttcggcctttccagataacgctgcccgcagagaggtg
gagagcctgccagctgtctgtcccaatgatggatgcacttggaaggggaccttgaaagaa
tacgagagctgccacgaaggactttgcccattcctgctgacggagtgtcctgcatgtaaa
ggcctggtccgcctcagcgagaaggagcaccacactgagcaggaatgccccaaaaggagc
ctgagctgccagcactgcagagcaccctgtagccacgtggacctggaggtacactatgag
gtctgccccaagtttcccttaacctgtgatggctgtggcaagaagaagatccctcgggag
acgtttcaggaccatgttagagcatgcagcaaatgccgggttctctgcagattccacacc
gttggctgttcagagatggtggagactgagaacctgcaggatcatgagctgcagcggcta
cgggaacacctagccctactgctgagctcattcttggaggcccaagcctctccaggaacc
ttgaaccaggtggggccagagctactccagcggtgccagattttggagcagaagatagca
acctttgagaacattgtctgcgtcttgaaccgtgaagtagagagggtagcagtgactgca
gaggcttgtagccggcagcaccggctagaccaggacaagattgaggccctgagtaacaag
gtgcaacagctggagaggagcatcggcctcaaggacctggccatggctgacctggagcag
aaggtctccgagttggaagtatccacctatgatggggtcttcatctggaagatctctgac
ttcaccagaaagcgtcaggaagccgtagctggccggacaccagctatcttctccccagcc
ttctacacaagcagatatggctacaagatgtgtctacgagtctacttgaatggcgacggc
actgggcggggaactcatctgtctctcttcttcgtggtgatgaaaggccccaatgatgct
ctgttgcagtggccttttaatcagaaggtaacattgatgttgctggaccataacaaccgg
gagcatgtgatcgacgcattcaggcccgatgtaacctcgtcctccttccagaggcctgtc
agtgacatgaacatcgccagtggctgccccctcttctgccctgtgtccaagatggaggcc
aagaattcctatgtgcgggatgatgcgatcttcatcaaagctattgtggacctaacagga
ctctag

DBGET integrated database retrieval system