KEGG   Mus musculus (mouse): 22031Help
Entry
22031             CDS       T01002                                 

Gene name
Traf3, AI528849, CAP-1, CD40bp, CRAF1, LAP1, T-BAM, TRAFAMN, amn
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    22031 (Traf3)
   04668 TNF signaling pathway
    22031 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    22031 (Traf3)
   04621 NOD-like receptor signaling pathway
    22031 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    22031 (Traf3)
   04657 IL-17 signaling pathway
    22031 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22031 (Traf3)
   05203 Viral carcinogenesis
    22031 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22031 (Traf3)
  09172 Infectious disease: viral
   05162 Measles
    22031 (Traf3)
   05164 Influenza A
    22031 (Traf3)
   05161 Hepatitis B
    22031 (Traf3)
   05160 Hepatitis C
    22031 (Traf3)
   05168 Herpes simplex virus 1 infection
    22031 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22031 (Traf3)
   05169 Epstein-Barr virus infection
    22031 (Traf3)
   05165 Human papillomavirus infection
    22031 (Traf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 MPS2 zf-C3HC4_2 Spc7 Spc29 Tropomyosin_1 T3SSipB FliJ KxDL BLOC1_2 DUF1664 zf-RING_6 DUF3450 SPATA24 LMBR1
Motif
Other DBs
NCBI-GeneID: 22031
NCBI-ProteinID: NP_035762
MGI: 108041
Ensembl: ENSMUSG00000021277
Vega: OTTMUSG00000031724
UniProt: Q60803 Q3UHJ1
LinkDB All DBs
Structure
PDB: 

Position
12 F1; 12 60.94 cM
AA seq 567 aa AA seqDB search
MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEG
RGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCK
SQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaagcaaaaagatggatgctgctggcacactgcagcctaacccacccctaaag
ctgcagcctgatcgcggcgcagggtccgtgctcgtgccggagcaaggaggctacaaggag
aagtttgtgaagacggtggaagacaagtacaagtgcgagaagtgccgcctggtgctgtgc
aacccgaagcagacggagtgtggccaccggttctgcgagagctgcatggccgccctgctg
agctcctccagtccaaaatgcacagcgtgccaagaaagcatcatcaaagacaaggtgttt
aaggataattgctgcaagagagagattctggcccttcaggtctactgtcggaatgaaggc
agaggttgtgcggagcagctgactctgggacatctgctggtgcacctaaaaaatgaatgt
cagtttgaggaacttccctgtctgcgtgccgactgcaaagaaaaagtactgagaaaagac
ttgcgggatcacgtggaaaaggcctgtaaataccgcgaggccacgtgcagtcactgcaag
agccaagtgcccatgatcaaactgcagaaacatgaagacacagattgtccctgtgtggtg
gtatcctgccctcacaagtgcagcgttcagactcttctaaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccatgaggccagctccgcggtacagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccctgctgcagaatgaaagt
gttgagaaaaacaagagcatccaaagcctgcacaaccagatctgcagctttgagatcgag
attgagaggcagaaggagatgctccgaaacaacgagtccaagatccttcacctgcagcgg
gtaatcgacagccaagcagagaaactgaaagaactggacaaggagatccgtcccttccgg
cagaactgggaggaagcggacagcatgaagagcagtgtggagtccctccagaaccgagtg
actgagctggagagcgtagacaaaagtgcggggcaggcggctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgttgagtgttcatgacatccgcttggccgac
atggacctgcggttccaggtcctcgagaccgccagctacaacggggtgctgatctggaag
atccgtgactacaagcgccggaagcaggaggccgtcatggggaagaccctgtctctctac
agccagcctttctacacaggttattttggctataagatgtgtgccagggtctacctgaat
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgtggagaa
tatgatgctctgttgccatggccgttcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgccgtcatctgggagatgcgttcaagcctgaccccaacagcagcagcttc
aagaaacccaccggagagatgaatatcgcctctggctgcccagtctttgtcgcccaaact
gttctagagaacgggacgtatattaaagatgatacaatctttattaaggtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system