KEGG   Mus musculus (mouse): 22033Help
Entry
22033             CDS       T01002                                 

Gene name
Traf5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    22033 (Traf5)
   04668 TNF signaling pathway
    22033 (Traf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    22033 (Traf5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22033 (Traf5)
   04657 IL-17 signaling pathway
    22033 (Traf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22033 (Traf5)
   05203 Viral carcinogenesis
    22033 (Traf5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22033 (Traf5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    22033 (Traf5)
   05168 Herpes simplex virus 1 infection
    22033 (Traf5)
   05163 Human cytomegalovirus infection
    22033 (Traf5)
   05169 Epstein-Barr virus infection
    22033 (Traf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22033 (Traf5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    22033 (Traf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 Sina zf-C3HC4_4 zf-TRAF_2 zf-RING_UBOX zf-C3HC4_3 Med4 zf-RING_6 zf-RING_2 ATG16 zf-RING_5 Exonuc_VII_L TFA2_Winged_2 Mod_r BLOC1_2
Motif
Other DBs
NCBI-GeneID: 22033
NCBI-ProteinID: NP_035763
MGI: 107548
UniProt: P70191 Q3UMS9
LinkDB All DBs
Structure
PDB: 

Position
1 H6; 1 97.11 cM
AA seq 558 aa AA seqDB search
MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGC
GHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARI
ILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNL
QDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLE
HERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFG
RNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLE
ASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREA
VEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIK
DDTLFLKVAVDLTDLEDL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctcattcggaggagcaagcggctgtcccctgcgccttcatccgccagaactctggc
aactcaatttccttggactttgagcccgacaccgagtaccagtttgtggagcagctggaa
gaacgctacaaatgtgccttctgccactccgtgcttcacaacccccaccagaccggctgc
gggcaccgcttctgccagcagtgcatccggtctctgagagaattgaactcggtgccgatc
tgcccggtagacaaggaggtcatcaagcctcaggaggtgttcaaagacaactgctgcaaa
agagaagttctcaatttacacgtctactgcaaaaacgcccccgggtgcaatgccaggatt
attctgggacgattccaggaccaccttcagcactgttccttccaagccgtgccctgccct
aacgagagctgccgggaagccatgctccggaaagacgtgaaagagcacctgagcgcatac
tgccggttccgagaggagaagtgcctttactgcaaaagggacatagtggtgaccaacctg
caggatcatgaggaaaactcgtgtcctgcgtacccagtgtcttgtcccaacaggtgtgtg
cagactattccaagagctagggtgaatgaacaccttactgtatgtcctgaggctgagcaa
gactgtccctttaagcactatggctgcactgtcaagggtaagcgggggaacttgctggag
catgagcgggcagccctgcaggaccacatgcttctggttttagagaagaactaccaacta
gaacagcggatctctgatttatatcagagtctcgaacagaaggaaagcaagatccagcag
ctggcagaaaccgtgaagaagttcgaaaaggagcttaagcagttcacacagatgtttggc
agaaatggaactttcctctcaaatgtccaggctctcaccagtcacacggacaagtcagct
tggctggaagcgcaggtgcggcagctgctacaaatagttaaccagcagccaagtcgactt
gatctgaggtctttggtggatgcggttgacagcgtgaaacagaggatcacccagctggaa
gccagtgaccagagattagttcttttagagggggagaccagcaagcacgacgcacacatt
aatatccacaaagcacagctgaataagaacgaagagcggtttaagcagctggagggcgcc
tgctacagtggcaagctcatctggaaggtgacagattacagggtgaagaagagggaggcc
gtggaggggcacacagtgtccgtcttcagccagcctttctacaccagccgctgcggctac
cggctctgtgccagggcgtacctgaacggggacgggtcggggaagggaacgcacctgtcc
ctgtactttgtggtgatgcgcggtgagtttgactcgctgctgcagtggccgttcaggcag
agggtgaccctgatgcttttggaccagagcggcaagaagaaccatattgtggagaccttc
aaagctgaccccaacagcagcagcttcaaaaggccagatggcgagatgaacattgcctct
ggctgtccccgctttgtgtcgcactctactctggagaactccaagaacacctacattaaa
gacgacacactgttcttgaaagtggccgtggatttaactgacttggaggatctgtag

DBGET integrated database retrieval system