KEGG   Mus musculus (mouse): 22034Help
Entry
22034             CDS       T01002                                 

Gene name
Traf6, 2310003F17Rik, AI851288, C630032O20Rik
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22034 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22034 (Traf6)
   04064 NF-kappa B signaling pathway
    22034 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22034 (Traf6)
   04140 Autophagy - animal
    22034 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    22034 (Traf6)
   04621 NOD-like receptor signaling pathway
    22034 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    22034 (Traf6)
   04657 IL-17 signaling pathway
    22034 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    22034 (Traf6)
  09158 Development
   04380 Osteoclast differentiation
    22034 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22034 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    22034 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22034 (Traf6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22034 (Traf6)
   05133 Pertussis
    22034 (Traf6)
   05152 Tuberculosis
    22034 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    22034 (Traf6)
   05162 Measles
    22034 (Traf6)
   05161 Hepatitis B
    22034 (Traf6)
   05160 Hepatitis C
    22034 (Traf6)
   05168 Herpes simplex virus 1 infection
    22034 (Traf6)
   05169 Epstein-Barr virus infection
    22034 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    22034 (Traf6)
   05140 Leishmaniasis
    22034 (Traf6)
   05142 Chagas disease (American trypanosomiasis)
    22034 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22034 (Traf6)
   04121 Ubiquitin system [BR:mmu04121]
    22034 (Traf6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22034 (Traf6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    22034 (Traf6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    22034 (Traf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 SlyX zf-TRAF_2 Tropomyosin_1 UPF0242 DUF4455 Sina PspA_IM30 zf-RING_11 U-box DUF16 Tropomyosin Spc29 TACC_C ADIP TMF_DNA_bd PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 22034
NCBI-ProteinID: NP_001290202
MGI: 108072
Ensembl: ENSMUSG00000027164
Vega: OTTMUSG00000014586
UniProt: P70196
LinkDB All DBs
Position
2; 2 E2
AA seq 530 aa AA seqDB search
MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIE
DCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPI
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPED
PNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcttaaactgtgagaacagctgcgggtccagccagtcgtccagtgactgctgc
gctgccatggccgcctcctgcagcgctgcagtgaaagatgacagcgtgagtggctctgcc
agcaccgggaacctctccagctccttcatggaggagatccagggctacgatgtggagttt
gacccacctctggagagcaagtatgagtgtcccatctgcttgatggctttacgggaagca
gtgcaaacaccatgtggccacaggttctgcaaagcctgcatcatcaaatccataagggat
gcagggcacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcccgac
aattttgcaaagcgagagattctttccctgacggtaaagtgcccaaataaaggctgtttg
caaaagatggaactgagacatctcgaggatcatcaagtacattgtgaatttgctctagtg
aattgtccccagtgccaacgtcctttccagaagtgccaggttaatacacacattattgag
gattgtcccaggaggcaggtttcttgtgtaaactgtgctgtgtccatggcatatgaagag
aaagagatccatgatcaaagctgtcctctggcaaatatcatctgtgaatactgtggtaca
atcctcatcagagaacagatgcctaatcattatgatctggactgcccaacagctccaatc
ccttgcacattcagtgtttttggctgtcatgaaaagatgcagaggaatcacttggcacga
cacttgcaagagaatacccagttgcacatgagactgttggcccaggctgttcataatgtt
aaccttgctttgcgtccgtgcgatgccgcctctccatcccggggatgtcgtccagaggac
ccaaattatgaggaaactatcaaacagttggagagtcgcctagtaagacaggaccatcag
atccgggagctgactgccaaaatggaaactcagagtatgtacgtgggcgagctcaaacgg
accattcggaccctggaggacaaggttgccgaaatggaagcacagcagtgtaacgggatc
tacatttggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaagacct
gttgtcatccatagccctggattctacacaggcagacctgggtacaagctgtgcatgcgc
ctgcatcttcagttaccgacagctcagcgctgtgcaaactatatatccctttttgtccac
acaatgcaaggagaatatgacagccacctcccctggcccttccagggtacaatacgcctt
acaattctcgaccagtctgaagcacttataaggcaaaaccacgaagaggtcatggacgcc
aaaccagaactgcttgcctttcagcgacccacaatcccacggaaccccaaaggttttggc
tatgtaacatttatgcacctggaagccttaagacagggaaccttcattaaggatgataca
ttactagtgcgctgtgaagtctctacccgctttgacatgggtggccttcggaaggagggt
ttccagccacgaagtactgatgcgggggtgtag

DBGET integrated database retrieval system