KEGG   Mus musculus (mouse): 22040
Entry
22040             CDS       T01002                                 

Gene name
Trex1, AU041952
Definition
(RefSeq) three prime repair exonuclease 1
  KO
K10790  three prime repair exonuclease 1 [EC:3.1.11.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    22040 (Trex1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22040 (Trex1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     22040 (Trex1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    22040 (Trex1)
SSDB
Motif
Pfam: RNase_H_2 RNase_T
Other DBs
NCBI-GeneID: 22040
NCBI-ProteinID: NP_001012236
MGI: 1328317
Ensembl: ENSMUSG00000049734
Vega: OTTMUSG00000055468
UniProt: Q91XB0
LinkDB
Structure
PDB: 

Position
9; 9 F2
AA seq 314 aa
MGSQTLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRP
PRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCC
LVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLG
SIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYGTPATTG
TTNLRPHAATATTPLATANGSPSNGRSRRPKSPPPEKVPEAPSQEGLLAPLSLLTLLTLA
IATLYGLFLASPGQ
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggctcacagaccctgccccatggtcacatgcagaccctcatcttcttagacctggaa
gccactggcctgccttcgtctcggcccgaagtcacagagctgtgcctgctggctgtccac
agacgtgctctggagaacacttccatttctcagggacatccacctccagtgcccagaccg
ccccgtgtggtggacaagctctctctgtgcattgctccagggaaagcctgtagccctggg
gccagtgagatcacaggtctgagcaaagctgagctggaagtacaggggcgtcaacgcttc
gatgacaacctggccatcctgctccgagccttcctgcagcgccagccacagccttgctgc
cttgtggcacacaacggtgaccgctatgactttcctctgctccagacagagcttgctagg
ctgagcactcccagtcccctagatggtaccttctgtgtggacagcatcgctgccctaaag
gccttggaacaagctagcagcccctcagggaatggttcgaggaaaagctacagcctgggc
agcatctacacccgcctgtactggcaagcaccgacagactcacatactgctgaaggtgat
gttctaaccctgctcagcatctgtcagtggaagccacaggccctactgcagtgggtggac
gaacatgcccggccctttagcaccgtcaagcccatgtacggcactccggctaccactgga
acaaccaacctaaggccacatgctgccacagctactacacccctggccacagccaatgga
agtcccagcaatggcaggagcaggcgacctaagagtcctcctccagagaaggtcccagaa
gccccatcacaggaggggctgctggccccactgagcctgctgaccctcctgaccttggca
atagccactctgtatggactcttcctggcctcacctgggcagtaa

DBGET integrated database retrieval system