KEGG   Mus musculus (mouse): 22241Help
Entry
22241             CDS       T01002                                 

Gene name
Ulk1, AU041434, Unc51.1, mKIAA0722
Definition
(RefSeq) unc-51 like kinase 1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    22241 (Ulk1)
   04150 mTOR signaling pathway
    22241 (Ulk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22241 (Ulk1)
   04137 Mitophagy - animal
    22241 (Ulk1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    22241 (Ulk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22241 (Ulk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22241 (Ulk1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22241 (Ulk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22241 (Ulk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   22241 (Ulk1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    22241 (Ulk1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    22241 (Ulk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3543 Kdo RIO1 Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 22241
NCBI-ProteinID: NP_033495
MGI: 1270126
Ensembl: ENSMUSG00000029512
Vega: OTTMUSG00000054223
UniProt: O70405 A0A0R4J0B3
LinkDB All DBs
Position
5; 5 F
AA seq 1051 aa AA seqDB search
MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGS
GSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMV
PAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGP
FSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTSPLGFGRASPSP
PSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVP
EHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRP
LRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTL
PDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQ
EKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSS
LGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQE
HTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQ
LVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQR
FFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQH
TLTDQADIENIAKCKLCIERRLSALLSGVYA
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggccgcggcggcgtcgagaccgtgggcaagttcgagttctctcgcaaggac
ctgattggacacggcgccttcgcggtggtcttcaagggtcgacaccgcgagaagcacgac
ctggaggtggccgtcaaatgcattaacaagaagaaccttgccaagtcccaaacactgctg
ggaaaggaaatcaaaatcctgaaggaactaaagcacgaaaacatcgtggcgctgtatgac
ttccaggaaatggctaattctgtctacctggtcatggagtattgtaatggtggagacctg
gctgactacctgcacactatgcgcacactgagtgaagacactgtcaggcttttcctacag
cagatcgctggcgccatgcggctgctgcacagcaagggcatcatccaccgggacctgaag
ccccaaaacatcctgctgtccaaccctgggggccgccgggccaaccccagcaacatccga
gtcaagattgctgactttggattcgctcggtacctccagagcaacatgatggcggccaca
ctctgtggttctcctatgtacatggctcctgaggtcattatgtcccagcactacgatgga
aaggctgacctgtggagcattggcaccattgtctaccagtgtctgacagggaaggcccct
tttcaggccagcagccctcaggatttgcgcctgttttatgagaagaacaagacactagtt
cctgccatcccccgggagacatcagctcccctgcggcagctgctcctggctctgttgcag
cggaaccacaaggaccgcatggactttgatgaatttttccaccaccctttcttggatgcc
agcacccccatcaagaaatccccacctgtgcctgtgccctcatatccaagctcagggtct
ggcagcagctccagcagcagctctgcctcccacctggcctctccaccgtccctgggggag
atgccacagctacagaagacccttacctccccagccgatgctgctggctttcttcagggc
tcccgggactctggtggcagcagcaaagactcctgtgacacagatgactttgtcatggtc
ccagcccagtttccaggtgatctagttgctgaggcagccagtgccaagcccccacctgat
agcctgctgtgtagtgggagctcattggtggcctctgctggcctagagagccacggccgt
accccctctccctctccgacctgcagcagctctcccagcccctctggccggcctggcccc
ttctccagcaacaggtacggtgcctcggtccccattcctgtccccactcaggtgcacaat
taccagcgcatcgagcaaaacctgcaatcgcccactcaacagcagacagccaggtcctct
gccatccgaaggtcagggagcaccagccccctgggctttggccgggccagcccatcaccc
ccctcccacaccgatggagccatgctggccaggaagctgtcacttggaggtggccgtccc
tacacaccttctccccaagtgggaaccatcccagagcgacccagctggagcagagtgccc
tccccacaaggagctgatgtgcgggttggcaggtcaccacgacccggttcctctgtgcct
gagcactctccaagaaccactgggctgggctgccgcctgcacagtgcccctaacctgtcc
gacttccatgttgtgcgtcccaagctgcctaagcccccaacagacccactgggagccacc
tttagcccaccccagaccagcgcaccccagccatgcccagggctacagtcttgccggcca
ctgcgtggctcacctaagctgcctgacttcctacagcggagtcccctaccccccatccta
ggctctcctaccaaggccgggccctcctttgacttccccaaaacccccagctctcagaat
ttgctgaccctgttggctaggcagggggtagtaatgacaccacctcggaaccgtacactg
cctgacctctccgaggccagtcctttccatggccagcagctgggctctggccttcggccc
gctgaagacacccggggtccctttggacggtccttcagcaccagccgcattacggacctg
ctgcttaaggctgcatttgggactcaggcctctgactcaggcagcacagacagcctacag
gagaaacctatggagattgctccctctgctggctttggagggactctgcatccaggagct
cgtggtggaggggccagcagcccagcacctgtggtatttactgtaggctccccacccagt
ggtgccaccccaccccagagtacccgtaccagaatgttctcagtgggctcttccagctcc
ctgggctctactggctcctcctctgcccgccacttagtgcctggggcctgtggagaggcc
ccggagctttctgccccaggccactgctgtagccttgctgacccccttgctgccaacttg
gagggggctgtgaccttcgaggctcctgacctcccagaggagaccctcatggagcaagag
cacacggaaaccctacacagtctgcgcttcacactagcgtttgcacagcaagttctggag
attgcagccctgaagggaagtgccagtgaggccgccggtggccctgagtaccagctccag
gaaagtgtggtggctgaccagatcagtcagttgagccgagagtggggctttgcagagcaa
ctggttctgtacttgaaggtggctgagctgctgtcctcaggcctacagactgccattgac
cagattcgagctggcaaactctgcctttcatctactgtgaagcaggtggtacgcagacta
aatgagctgtacaaggccagcgtggtatcctgccagggcctcagcttgcgacttcagcgc
ttctttctggacaaacaacggctgctggacgggatccatggtgtcactgcagagcggctc
atcctcagccatgctgtgcaaatggtacaatcagctgcccttgatgagatgttccagcac
cgagagggctgtgtaccgagatatcacaaagccctgctattgctggaggggttgcagcac
actctcacggaccaggcagacattgagaacattgccaaatgcaagctgtgcattgagagg
agactctcggccctgctgagtggtgtctatgcctga

DBGET integrated database retrieval system