KEGG   Mus musculus (mouse): 22324Help
Entry
22324             CDS       T01002                                 

Gene name
Vav1, Vav, vav-T
Definition
(RefSeq) vav 1 oncogene
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    22324 (Vav1)
   04024 cAMP signaling pathway
    22324 (Vav1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22324 (Vav1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22324 (Vav1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22324 (Vav1)
   04660 T cell receptor signaling pathway
    22324 (Vav1)
   04662 B cell receptor signaling pathway
    22324 (Vav1)
   04664 Fc epsilon RI signaling pathway
    22324 (Vav1)
   04666 Fc gamma R-mediated phagocytosis
    22324 (Vav1)
   04670 Leukocyte transendothelial migration
    22324 (Vav1)
   04062 Chemokine signaling pathway
    22324 (Vav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22324 (Vav1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22324 (Vav1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH3_9 SH2 C1_1 PH CDC24 LZ3wCH C1_2 DUF4335 PH_16 PH_10
Motif
Other DBs
NCBI-GeneID: 22324
NCBI-ProteinID: NP_035821
MGI: 98923
Ensembl: ENSMUSG00000034116
Vega: OTTMUSG00000036994
UniProt: P27870 Q3U9E2
LinkDB All DBs
Structure
PDB: 

Position
17 D; 17 29.76 cM
AA seq 845 aa AA seqDB search
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRL
ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI
EELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH
GPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKI
MTSEGLYRITEKKAFRGLLELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED
YSEYC
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagctctggcgacagtgcacccactggctgatccagtgtcgggtgctgcctcccagc
caccgtgtgacctgggagggggcccaggtgtgtgagctggcacaggcactgcgggacggt
gtcctcttgtgccaattgcttaacaacctgcttccccaggccattaatcttcgcgaggtt
aacttgcggccccagatgtcccagttcctttgtcttaagaacattcgaaccttcctgtct
acttgctgtgagaagttcggcctcaagcgcagtgaactctttgaggcttttgacctcttc
gatgtgcaggactttggaaaggtcatctacaccctgtctgctctgtcatggacacccatt
gcccagaacaaaggaatcatgcccttcccaacagaggacagcgctctgaacgacgaagat
atttacagtggcctttcagaccagattgatgacaccgcagaggaagacgaggacctttat
gactgcgtggaaaatgaggaggcagagggggacgagatctacgaggacctaatgcgcttg
gagtcggtgcctacgccacccaagatgacagagtatgataagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtatacagacacactgggctccatccagcagcacttc
atgaagcctctgcagcgattccttaagcctcaagacatggagaccatctttgtcaacatt
gaggagctgttctctgtgcatacccacttcttaaaggaactgaaggatgccctggctggc
ccgggagcaacaacactgtatcaggtcttcatcaagtacaaggagaggttcctggtttat
ggccgttattgcagtcaggtggagtcagccagcaagcacttggatcaagtggccacagca
cgggaggatgtgcagatgaagctggaggaatgttctcaaagagctaacaatggccgattc
accctacgggatctgctgatggtacctatgcagcgggtgctgaagtaccacctccttctc
caggagctagtgaaacacacacaggatgctacagagaaggagaacctgcggttggccctg
gacgccatgagggacctggcacagtgcgtgaacgaggtcaagagggacaatgaaacccta
cggcagatcacaaactttcagctgtccattgagaacctggaccagtctctggctaactat
ggccggcccaagattgacggtgagctcaagattacctcagtggagcgtcgctcaaagaca
gacaggtatgccttcctgctggacaaagcactgctcatctgtaaacgccgcggggactct
tacgacctcaaagcctcggtgaacttgcacagcttccaagttcgagatgactcctccggg
gagcgagacaacaagaagtggagccatatgttccttctgattgaggatcaaggcgcccag
ggctatgagctgttcttcaagactcgggagctgaagaagaagtggatggaacagttcgaa
atggccatctccaacatttacccagagaatgctacagccaatgggcatgattttcagatg
ttctcctttgaggagaccacttcctgcaaggcctgccagatgttactcagaggcacattc
taccagggatatcgctgttacaggtgccgggcacctgcacacaaggagtgtctggggaga
gtgcctccctgtggtcgccatgggcaagatttcgcaggaaccatgaagaaggacaagctc
catcgaagggcccaggacaagaaaaggaatgaattgggtctgcctaagatggaagtgttt
caggaatactatgggatccctcctccacctggagcctttgggccatttttacggctcaac
cctggggacattgtggagctcactaaggcagaggctgagcacaactggtgggagggaagg
aatactgctacaaatgaagtcggctggtttccctgtaacagagtgcatccctatgtccac
ggccctcctcaggacctgtctgtgcatctctggtatgcgggccctatggaacgagcaggc
gctgagggcatcctcaccaaccgttctgatgggacctatctggtgcggcagagggtgaaa
gatacagcggagttcgccatcagcattaagtataacgtggaggtcaagcatattaaaatc
atgacgtcagaggggttgtaccggatcacagagaagaaggctttccggggccttctggaa
ctggtagagttttatcagcagaattccctcaaagattgcttcaagtcgttggacaccacc
ttgcagtttccttataaggaacctgagaggagagccatcagcaagccaccagctggaagc
accaagtattttggcactgccaaagcccgctacgacttctgtgcccgggacaggtcggaa
ctgtcccttaaggagggtgatatcatcaagatcctcaataagaagggacagcaaggctgg
tggcgtggggagatctacggccggatcggctggttcccttctaactatgtggaggaagac
tattccgaatattgctga

KEGG   Mus musculus (mouse): 22325Help
Entry
22325             CDS       T01002                                 

Gene name
Vav2, 2810040F13Rik, AI847175, Vav-2
Definition
(RefSeq) vav 2 oncogene
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    22325 (Vav2)
   04024 cAMP signaling pathway
    22325 (Vav2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22325 (Vav2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22325 (Vav2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22325 (Vav2)
   04660 T cell receptor signaling pathway
    22325 (Vav2)
   04662 B cell receptor signaling pathway
    22325 (Vav2)
   04664 Fc epsilon RI signaling pathway
    22325 (Vav2)
   04666 Fc gamma R-mediated phagocytosis
    22325 (Vav2)
   04670 Leukocyte transendothelial migration
    22325 (Vav2)
   04062 Chemokine signaling pathway
    22325 (Vav2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22325 (Vav2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22325 (Vav2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH SH2_2 CDC24 PH_10 Zn_ribbon_17 C1_2 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 22325
NCBI-ProteinID: NP_033526
MGI: 102718
Ensembl: ENSMUSG00000009621
Vega: OTTMUSG00000012034
UniProt: Q60992 Q7TSI6
LinkDB All DBs
Position
2 A3; 2 19.36 cM
AA seq 868 aa AA seqDB search
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSTLNQLLASRE
DFRQKVEECTLRVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYLCTRCGVGAHKECLEVIPPCKMSSPADVDAPGAGPGPKMVAVQNYHGNPAPPGKPVLT
FQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPTGRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERTTSRASSRSPASCASYNF
SFLSPQGLSFAPQAPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIG
GDQGWWKGETNGRIGWFPSTYVEEEGVQ
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggcggcaatgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggc
gtccttctgtgccagctgctgcacaacctctcccccggttccatcgaccttaaggacatc
aacttccggccgcagatgtcccagttcttgtgtctgaagaatattcgcaccttcctcaaa
gtctgccatgacaaatttggactaagaaacagtgagctgtttgaccctttcgacctcttt
gatgtccgagacttcgggaaggtcatctctgcagtgtcccgtctgtccctgcacagcatc
gcacagagcaaagggatcaggccatttccatcagaggagacagctgaaaatgatgacgac
gtctaccggagcctggaagagctggctgacgagcatgacctgggtgaggacatctacgac
tgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtg
cagcagcccatgaaaatgggcatgactgaggacgacaagagaagctgctgcttgttagag
attcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatg
ggtcccttgcggctggtgctgagcccggcggatatggctgctgtcttcatcaacctggag
gacctcatcaaggtgcatcacagctttctgcgagccatcgatgtgtccatgatggctggt
ggcagtaccctggctaaggtctttctggagtttaaggaaaggctcctgatctatggagag
tactgtagccacatggaacacgctcagagtacactgaaccagctcctcgccagccgagag
gacttcaggcagaaagtggaggagtgcacactcagggttcaggatggcaagttcaagctg
caagacctgctggtggtgcccatgcaacgggtgctgaagtaccacctgctgctcaaggag
ctcctgagccattctgcagaccgaccagaaagacaacagctcaaagaagccctggaagcc
atgcaggacttggccatgtacatcaatgaagtgaagcgggacaaggagaccttgaagaag
attagcgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggagg
ccaaagattgacggggagcttaaagtccggtccatagtcaaccacaccaagcaagacagg
tacctgttcctatttgacaaggtggtcatcgtgtgcaagaggaagggctacagctatgag
ctgaaggaggtcattgagctgctcttccacaagatgaccgatgacccgatgcacaacaag
gacatcaagaagtggtcctatggcttctacctgattcacctccaaggaaagcaaggcttt
cagttcttctgcaagacggaagacatgaagcggaagtggatggagcagttcgagatggcc
atgtcaaacatcaagccagataaggccaatgccaaccatcatagcttccagatgtacaca
ttcgacaagactaccaactgcaaagcctgcaagatgtttctcaggggtaccttctaccag
ggatacctgtgtaccagatgtggcgtcggggcacacaaggaatgcctggaggtgatcccc
ccctgcaagatgagttcacctgcagatgtggatgctcctggagcaggaccaggtcccaag
atggttgctgtgcagaattaccatggtaacccagcccctcctgggaagcctgtgttgacc
ttccagacaggagacgtgatagaactgctccggggtgaccccgattctccttggtgggaa
gggcggctggttcaaaccaggaagtcagggtattttcccagctcatctgtgaagccctgc
ccagtggatggaaggccgcctactggccgcccaccatcccgggagatcgattacactgcc
tacccgtggtttgctggcaacatggaacggcagcagacggacaatctgctcaagtctcat
gccagtgggacctacctcatcagagagcgtccagcagaggcagaacgcttcgccatcagc
atcaagttcaatgatgaggtgaaacatatcaaggtggtggagaaagatagctggatccac
atcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgtcac
tcactcaaggaaagcttcaagcagttggacactacactcaagttcccctacaagtctcgg
gagcgaaccaccagcagggcctcaagccggtctccagcttcctgcgcttcctacaacttt
tcttttctcagtcctcagggcctcagctttgccccccaggccccttctgctcccttctgg
tcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgctcga
gacatgcgggagctgtcactgcgagaaggtgatgtggtgaagatctacagccgaattggt
ggggaccagggctggtggaaaggagagacaaatgggcggatcggttggtttccttcgacg
tacgtggaagaggaaggcgtccagtga

KEGG   Mus musculus (mouse): 57257Help
Entry
57257             CDS       T01002                                 

Gene name
Vav3, A530094I06Rik, AA986410, Idd18.1
Definition
(RefSeq) vav 3 oncogene
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    57257 (Vav3)
   04024 cAMP signaling pathway
    57257 (Vav3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    57257 (Vav3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    57257 (Vav3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    57257 (Vav3)
   04660 T cell receptor signaling pathway
    57257 (Vav3)
   04662 B cell receptor signaling pathway
    57257 (Vav3)
   04664 Fc epsilon RI signaling pathway
    57257 (Vav3)
   04666 Fc gamma R-mediated phagocytosis
    57257 (Vav3)
   04670 Leukocyte transendothelial migration
    57257 (Vav3)
   04062 Chemokine signaling pathway
    57257 (Vav3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    57257 (Vav3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    57257 (Vav3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH2 SH3_9 C1_1 PH CDC24 Filamin PH_10 PH_16 Prok-RING_1 C1_2 IQ_SEC7_PH LZ3wCH Spt5_N Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 57257
NCBI-ProteinID: NP_065251
MGI: 1888518
Ensembl: ENSMUSG00000033721
Vega: OTTMUSG00000007363
UniProt: Q9R0C8
LinkDB All DBs
Position
3; 3 F3
AA seq 847 aa AA seqDB search
MEPWKQCAQWLIHSKVLPPNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEI
NLRPQMSQFLCLKNIRTFLAACCDTFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAQQPKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPD
LVKVHRSLMQEIHDSIVNKDDQNLYQVFINYKERLVIYGQYCSGVESAISNLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDPMEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQ
GYLCFKCGAKAHKECLGRVDNCGRVNSVEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVI
RNYTGTPAPGLHEGPPLHIQAGDTVELLRGDAHSVFWQGRNLASGEVGFFPSDAVKPSPC
VPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGNRT
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgctcagtggctcatccacagcaaggtgctgccccccaac
catcgggtgacctgggactcggcgcaggtgttcgacctggcgcagacccttcgcgatgga
gtcctgctctgccagctgctcaacaacctgcggccacactccatcaatctgaaggagatc
aacctgaggccccagatgtcccagtttctctgtttgaagaacatccggacattcctggcc
gcctgctgcgatacctttggaatgaggaaaagtgaactttttgaggcatttgacctattt
gatgttcgagactttggaaaggttatagaaacattatctcggctatcccgaacaccaata
gcattggccacaggaatcaggccgttccccactgaagaaagtataaatgatgaagacatc
tacaaaggccttcccgacttaatagatgaaacccgcgtggaagatgaagaagacctctat
gactgtgtgtacggcgaggatgaaggcggagaagtctatgaagacttgatgaaggcggag
gaagcccagcaacctaaatcacaagaaaatgatatacggagttgttgcctagcagaaatt
aggcagacagaagaaaaatacacagaaacgttggagtcaatagaaaaatatttcatggca
ccattgaaaagatttctgacggcggcggaatttgattcagtatttattaacattcctgac
cttgtaaaagttcatcggagcttaatgcaagagattcatgattccattgtaaataaagat
gaccagaacttgtatcaagtttttattaactacaaggaaagattggttatttatgggcag
tactgcagtggagtggagtcagccatctctaacctagactacatctctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttcaaaaagagccaataacgggaagtttactctg
cgcgatttgctggtcgttccaatgcagcgcgtgctgaagtatcacctcctccttcaggag
ctggtaaaacacacccatgaccctatggagaaggcgaacctgaagctggctctggatgca
atgaaggacttggcacaatatgtgaatgaagtaaaaagagataatgagacccttcgtgaa
attaagcagtttcagctatctatagagaatttgaaccagccagttttgctctttggacga
ccacagggagacggtgaaatccgaataaccactctggacaagcatacaaaacaagaaagg
catatcttcttattcgacttggcagtgattgtctgtaaaaggaaaggcgataactacgag
atgaaggaaataatagatctccagcagtacaagatagccaacaaccctaccactgacaaa
gagaataaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaaaaaatggctggaacagtttgaaatggct
ctatccaacataaggccagactatgcagactccaatttccatgatttcaagatgcacacc
ttcactcgggtgacatcctgcagggtctgccagatgctcctgaggggaacattttatcaa
ggctacttatgttttaagtgtggagcaaaagcacataaagaatgtttgggaagagtagac
aattgtggcagagttaattccgttgaacaagggccattcaaaccaccagagaaacggacc
aatggacttcggagagcttccagacaggtggacccaggtttgccgaagatgcaggtcatt
aggaactacactggcaccccggccccagggcttcatgaaggaccaccattgcatatccag
gcaggcgacactgttgaacttctgagaggagatgcacacagtgtgttctggcagggacga
aacttagcttcaggagaggttggatttttcccaagtgatgctgtcaaaccctctccatgt
gtacctaaaccagtagattattcttgccaaccctggtatgctggcccaatggaaagattg
caggcagaaactgaacttattaacagggtgaatagtacttaccttgtaaggcacaggacc
aaagaatctggagaatatgcaattagcattaagtacaataatgaagcaaaacacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagcttaatg
gaacttgtggagtactacaagcaccattctctcaaagaagggttcaggaccttagataca
acgctacagtttccatacaaggagccagaacagccagctggacagaggggtaatagaaca
ggcaacagcttgttgagtcccaaagtactgggtattgccatcgctcggtacgacttctgt
gcaagagatatgcgggagctctccctattgaaaggagacatggtgaagatttacacgaag
atgagtgcaaatggctggtggagaggtgaagtaaatggcagggtgggctggtttccatcc
acatatgtggaagaagatgaataa

DBGET integrated database retrieval system