KEGG   Mus musculus (mouse): 22329Help
Entry
22329             CDS       T01002                                 

Gene name
Vcam1, CD106, Vcam-1
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  vascular cell adhesion molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    22329 (Vcam1)
   04668 TNF signaling pathway
    22329 (Vcam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22329 (Vcam1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    22329 (Vcam1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22329 (Vcam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22329 (Vcam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    22329 (Vcam1)
   05143 African trypanosomiasis
    22329 (Vcam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    22329 (Vcam1)
   04091 Lectins [BR:mmu04091]
    22329 (Vcam1)
CD molecules [BR:mmu04090]
 Proteins
  22329 (Vcam1)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  22329 (Vcam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set ICAM_N C2-set_2 Ig_6 Ig_4 Ig_5 Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 22329
NCBI-ProteinID: NP_035823
MGI: 98926
Ensembl: ENSMUSG00000027962
Vega: OTTMUSG00000054446
UniProt: Q3UPN1
LinkDB All DBs
Position
3 G1; 3 50.17 cM
AA seq 739 aa AA seqDB search
MPVKMVAVLGASTVLWILFAVSQAFKIEISPEYKTIAQIGDSMALTCSTTGCESPLFSWR
TQIDSPLNAKVRTEGSKSVLTMEPVSFENEHSYLCTATCGSGKLERSIHVDIYSFPKDPE
IQFSGPLEVGKPVTVKCLAPDIYPVYRLEIDLFKGDQLMNRQEFSSEEMTKSLETKSLEV
TFTPVIEDIGKALVCRAKLHIDQIDSTLKERETVKELQVYISPRNTTISVHPSTRLQEGG
AVTMTCSSEGLPAPEIFWGRKLDNEVLQLLSGNATLTLIAMRMEDSGVYVCEGVNLIGRD
KAEVELVVQEKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSFSWRTQTDSPLNGVVR
NEGAKSTLVLSSVGFEDEHSYLCAVTCLQRTLEKRTQVEVYSFPEDPVIKMSGPLVHGRP
VTVNCTVPNVYPFDHLEIELLKGETTLMKKYFLEEMGIKSLETKILETTFIPTIEDTGKS
LVCLARLHSGEMESEPKQRQSVQPLYVNVAPKETTIWVSPSPILEEGSPVNLTCSSDGIP
APKILWSRQLNNGELQPLSENTTLTFMSTKRDDSGIYVCEGINEAGISRKSVELIIQVSP
KDIQLTVFPSKSVKEGDTVIISCTCGNVPETWIILKKKAKTGDMVLKSVDGSYTIRQAQL
QDAGIYECESKTEVGSQLRSLTLDVKGKEHNKNYFSPELLALYCASSLVIPAIGMIVYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaagatggtcgcggtcttgggagcctcaacggtactttggatactgtttgca
gtctctcaagcttttaaaatcgagatctcccctgaatacaaaacgattgctcaaatcggt
gactccatggccctcacttgcagcactacgggctgcgagtcaccattgttctcatggaga
acccagatagacagcccactaaacgcgaaggtgaggacggaggggtccaagtccgttctg
accatggagcctgtcagttttgagaatgaacactcttacctgtgcacagcaacatgtggc
tctgggaagctggaacgaagtatccacgtggacatctactctttccccaaggatccagag
attcaattcagtggccccctggaggttgggaagccggtcacggtcaagtgtttggctcca
gacatttacccagtttacaggctggagattgatctgttcaagggtgaccagctcatgaac
agacaggagttttcttcagaagagatgacaaagtctctagaaaccaagagtttggaagta
acctttactcccgtcattgaggatattggaaaagctcttgtttgccgagctaaattacac
attgaccaaattgattctacactcaaagaaagggagactgtcaaagaactacaagtctac
atctctcccaggaatacaacgatctctgtacatccctccacaaggcttcaagagggtggt
gctgtgacaatgacctgttccagcgagggtctaccagctcctgagattttctggggcagg
aagttagataatgaagttctccagcttctctcaggaaatgccaccctcaccttaattgct
atgaggatggaagactctggagtctatgtgtgtgaaggagttaatctgattgggagagac
aaagcagaagtggaattagttgttcaagagaaaccatttattgttgacatctcccccgga
tctcaggtggctgcacaagttggggattcggttgttctgacgtgtgctgctattggctgt
gactccccttctttttcttggagaacccagacagacagtcccctcaatggggtggtaagg
aatgagggggccaaatccacgcttgtgttgagctctgtgggttttgaggatgaacactct
tacctgtgcgctgtgacctgtctgcaaaggacactggaaaagagaacccaggtggaggtc
tactcattccctgaagatccagtaattaaaatgagtgggccacttgtgcatgggagacct
gtcactgtcaactgcacagtccctaatgtgtatccctttgaccatctggagattgaatta
ctgaagggggagactacactgatgaagaaatattttttggaggaaatgggcataaagtcc
ctagagaccaaaattttggaaacgaccttcatccccaccattgaagataccgggaaatct
cttgtttgcctcgctaggttacacagtggtgaaatggaatctgaacccaaacagaggcag
agtgtacagcctctttatgtcaacgttgcccccaaggaaaccaccatctgggtcagcccc
tctcctatactagaggagggcagtcctgtgaacctgacctgctcaagtgatgggatacca
gctcccaaaatcctgtggagcagacagctaaataatggggaactgcagcctctttctgaa
aatactacactcaccttcatgtctacaaaaagggacgattccggcatttatgtgtgtgaa
gggattaacgaggctggaattagcagaaaatcagttgaactgattatccaagtctctcca
aaagatatacagcttacagtctttccatctaagagtgtcaaagagggagacaccgtcatt
atctcctgcacttgtggaaatgtgcccgaaacatggataatcctgaagaagaaagcaaag
acaggagacatggtattaaagtctgtggatggctcgtacaccatccgccaggcacagctg
caggatgccggcatatacgagtgtgaatctaagactgaagttggctcacaattaagaagt
ttaacacttgatgtaaaaggaaaagaacataacaagaactatttttcgcccgaactcctt
gcactctactgcgcatcttccttggtaatacctgccatcgggatgatcgtttattttgca
agaaaagctaacatgaaaggatcgtacagtctggtggaggcacagaaatccaaagtgtag

DBGET integrated database retrieval system