KEGG   Mus musculus (mouse): 22339Help
Entry
22339             CDS       T01002                                 

Gene name
Vegfa, Vegf, Vpf
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22339 (Vegfa)
   04015 Rap1 signaling pathway
    22339 (Vegfa)
   04010 MAPK signaling pathway
    22339 (Vegfa)
   04370 VEGF signaling pathway
    22339 (Vegfa)
   04066 HIF-1 signaling pathway
    22339 (Vegfa)
   04151 PI3K-Akt signaling pathway
    22339 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22339 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22339 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22339 (Vegfa)
   05206 MicroRNAs in cancer
    22339 (Vegfa)
   05205 Proteoglycans in cancer
    22339 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    22339 (Vegfa)
   05211 Renal cell carcinoma
    22339 (Vegfa)
   05219 Bladder cancer
    22339 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    22339 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22339 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22339 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    22339 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22339 (Vegfa)
   05165 Human papillomavirus infection
    22339 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    22339 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22339 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22339 (Vegfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22339 (Vegfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   22339 (Vegfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF Cnd1_N
Motif
Other DBs
NCBI-GeneID: 22339
NCBI-ProteinID: NP_001273985
MGI: 103178
Ensembl: ENSMUSG00000023951
Vega: OTTMUSG00000016285
UniProt: Q00731
LinkDB All DBs
Position
17 C; 17 22.79 cM
AA seq 214 aa AA seqDB search
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggagagcagaagtcccatgaagtgatc
aagttcatggatgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgcgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagacagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system