KEGG   Mus musculus (mouse): 22346Help
Entry
22346             CDS       T01002                                 

Gene name
Vhl, Vhlh, pVHL
Definition
(RefSeq) von Hippel-Lindau tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22346 (Vhl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    22346 (Vhl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22346 (Vhl)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    22346 (Vhl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22346 (Vhl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     22346 (Vhl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHL VHL_C
Motif
Other DBs
NCBI-GeneID: 22346
NCBI-ProteinID: NP_033533
MGI: 103223
Ensembl: ENSMUSG00000033933
Vega: OTTMUSG00000024147
UniProt: P40338 Q3TTE7
LinkDB All DBs
Position
6 E3; 6 52.81 cM
AA seq 181 aa AA seqDB search
MPRKAASPEEAAGEPGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGE
PQPYPILPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLP
VYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEE
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgccccggaaggcagccagtccagaggaggcggcgggggagcccggtcctgaggagatg
gaggctgggcggccgcggccggtgctgcgctcggtgaactcgcgcgagccctctcaggtc
atcttctgcaaccgcagcccgcgcgtcgtgctgcctttgtggctcaacttcgacggcgag
cctcagccctacccgatcttaccaccgggcaccggccgccgcatccacagctaccgaggt
catctttggctcttcagggatgcggggacccatgatggacttctggttaaccaaacggag
ctgtttgtgccatccctcaatgtcgatggacagcctatttttgccaacatcacattgcca
gtgtataccctgaaagagcggtgccttcaggttgtgcggagcctggtcaagcctgagaac
tacaggagactggacatcgtcaggtcactctatgaggatttggaggactacccaagtgtg
cggaaggacatacagcgactgagccaagagcaccttgagagtcagcacctggaagaggag
ccttga

DBGET integrated database retrieval system