KEGG   Mus musculus (mouse): 22410Help
Entry
22410             CDS       T01002                                 

Gene name
Wnt10b, Wnt12
Definition
(RefSeq) wingless-type MMTV integration site family, member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    22410 (Wnt10b)
   04390 Hippo signaling pathway
    22410 (Wnt10b)
   04150 mTOR signaling pathway
    22410 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22410 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    22410 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22410 (Wnt10b)
   05205 Proteoglycans in cancer
    22410 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    22410 (Wnt10b)
   05226 Gastric cancer
    22410 (Wnt10b)
   05217 Basal cell carcinoma
    22410 (Wnt10b)
   05224 Breast cancer
    22410 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    22410 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22410 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22410 (Wnt10b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Morphogens
   22410 (Wnt10b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 22410
NCBI-ProteinID: NP_035848
MGI: 108061
Ensembl: ENSMUSG00000022996
UniProt: P48614 Q1RME7
LinkDB All DBs
Position
15 F1; 15 54.65 cM
AA seq 389 aa AA seqDB search
MLEEPRSRPPPLGLAGLLFLALFSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSP
VPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggagccccggtctcggcctccgcccttaggcctcgcgggtctcctgttcttg
gctttgttcagtcgggctctaagcaatgagattctgggccttaaacttcccggtgagccg
ccgctgacggccaacaccgtgtgcttgaccctgtccggactgagtaagcgacagctgggg
ctgtgcctgcgcagccccgacgtgacggcgtcggcgctccaggggctgcacatcgccgtt
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcactggagggcggc
ggccggctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgctttctcc
ttctccatgctggctgctggggtcatgcatgctgttgccacagcctgcagcctgggcaag
ctggtgagctgcggctgcggatggaagggtagtggtgagcaagaccggcttagagccaag
ctgctgcagcttcaggcactgtctcggggcaagactttccccatctcccagcccagccct
gttcctggctcagtccccagccccggcccccaggacacgtgggaatggggtggctgtaac
cacgacatggacttcggagagaagttctctcgggatttcttggattccagggaggctccc
cgggacatccaggcgagaatgcggatccacaacaacagggtgggacgccaggtggtaacg
gaaaacctgaagcggaagtgcaaatgccatggaacgtcaggcagctgccaattcaagacc
tgttggagggcagcgccagagttccgggccatcggggcagcactgagggagcggctgagc
agagccatctttatcgatacccacaaccgcaactctggagcgttccagccccgcctacgt
ccgcggcgcctctctggagagctggtttactttgagaagtctcctgacttctgcgagcga
gaccctactctgggctccccaggcacgagaggccgggcttgcaacaagaccagccgcctc
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtgctccggcagacgcga
gtggagcgctgccactgtcgtttccactggtgctgttatgtgctgtgtgatgagtgtaaa
gtcacagagtgggtcaatgtgtgtaaatga

DBGET integrated database retrieval system