KEGG   Mus musculus (mouse): 225471Help
Entry
225471            CDS       T01002                                 

Gene name
Ticam2, B430113A10, TICAM-2, TRAM, Tirp, Trif
Definition
(RefSeq) toll-like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu05133  Pertussis
mmu05161  Hepatitis B
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    225471 (Ticam2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    225471 (Ticam2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    225471 (Ticam2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    225471 (Ticam2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    225471 (Ticam2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    225471 (Ticam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 225471
NCBI-ProteinID: NP_775570
MGI: 3040056
Ensembl: ENSMUSG00000056130
Vega: OTTMUSG00000033482
UniProt: Q8BJQ4
LinkDB All DBs
Position
18; 18 C
AA seq 232 aa AA seqDB search
MGVGKSKLDKCPLSWHKKDSVDADQDGHESDSKNSEEACLRGFVEQSSGSEPPTGEQDQP
EAKGAGPEEQDEEEFLKFVILHAEDDTDEALRVQDLLQNDFGIRPGIVFAEMPCGRLHLQ
NLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVSRQHKYNSVIPMRPLNSPLPRE
RTPLALQTINALEEESQGFSTQVERIFRESVFERQQSIWKETRSVSQKQFIA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgggaagtctaaactagataagtgccccctttcttggcataaaaaagacagt
gtggatgccgatcaagacggccatgagtcagactccaagaattctgaggaagcctgcttg
cgtggttttgtggagcagagcagtggatcagagccaccaacaggagagcaggaccaacct
gaggcaaagggggcggggcctgaggagcaagatgaagaagagttcctcaaatttgtgata
cttcatgcagaagatgacaccgacgaggccctcagagtccaggatctactgcaaaacgac
tttggtatcaggccggggatcgttttcgccgagatgccgtgcggaagactgcatttgcag
aatctagacgatgcggtcaatgggtcggcctggaccatcttgttactgactgagaacttc
ctaagagacacctggtgtaacttccagttctacacttccctgatgaattctgtgagcagg
cagcacaagtacaactccgtcatacccatgcggcccctgaacagccctcttccccgggaa
cggactcccttggcgctgcaaaccatcaatgccttagaggaagaaagtcaaggcttttcc
acacaagtggagagaattttccgggagtctgtatttgagaggcaacaaagtatatggaaa
gagacacgaagtgtgtcgcagaaacagttcattgcctga

DBGET integrated database retrieval system