KEGG   Mus musculus (mouse): 22637Help
Entry
22637             CDS       T01002                                 

Gene name
Zap70, Srk, ZAP-70, mrtle, mur
Definition
(RefSeq) zeta-chain (TCR) associated protein kinase
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05135  Yersinia infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22637 (Zap70)
   04064 NF-kappa B signaling pathway
    22637 (Zap70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22637 (Zap70)
   04660 T cell receptor signaling pathway
    22637 (Zap70)
   04658 Th1 and Th2 cell differentiation
    22637 (Zap70)
   04659 Th17 cell differentiation
    22637 (Zap70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    22637 (Zap70)
  09163 Immune disease
   05340 Primary immunodeficiency
    22637 (Zap70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22637 (Zap70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22637 (Zap70)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     22637 (Zap70)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SYK family
   22637 (Zap70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 22637
NCBI-ProteinID: NP_001276694
MGI: 99613
Ensembl: ENSMUSG00000026117
Vega: OTTMUSG00000049481
UniProt: P43404
LinkDB All DBs
Position
1 B; 1 15.41 cM
AA seq 618 aa AA seqDB search
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCQFYSQDPDGLPCNLRKPCNRPPGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGDALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
QQTDGKFLLRPRKEQGTYALSLVYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYRLKEVCPNSSASAAVAAPTLPAHPSTFTQPQRRVDTLNSDGYTPEPARLASS
TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGSVRQGVYRMRK
KQIDVAIKVLKQGTEKADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGP
LHKFLLGKKEEIPVSNVAELLHQVAMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFG
LSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPYK
KMKGPEVLDFIKQGKRMECPPECPPEMYALMSDCWIYKWEDRPDFLTVEQRMRNYYYSLA
SRAEGPPQCEQVAEAACG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatcccgcggcgcacctgccattcttctatggcagcatctcgcgggctgaggcc
gaggagcacctgaagctggcaggcatggccgacgggctgttcctcctgcgccagtgtttg
cgctccctgggcggctacgtgctgtcgttggtgcacgacgtgcgcttccaccatttcccc
atcgagcgccaactcaacggcacgtacgccatcgcgggcgggaaggcgcactgcggcccg
gccgagctctgccagttctactctcaggaccccgacgggctgccctgcaacctgcgtaag
ccgtgtaaccggccgcccggactggagccacagcccggggtcttcgactgcctgcgtgat
gctatggtgcgcgactacgtgcgccagacctggaagctggagggcgatgcactagagcag
gccatcatcagccaggccccacaggtggagaagctcattgctaccacagcccacgagcga
atgccctggtatcacagcagcctgactcgtgaggaggccgagcgcaaactctattccggc
cagcagaccgacggcaagttcctgctgaggccccggaaggagcagggcacatatgcactg
tccctggtctatgggaaaactgtataccactatctcatcagccaggacaaggctggcaag
tactgcatccccgaaggcaccaagtttgacacgctctggcagctggtggagtacctgaag
ctgaaggcggatggactaatttaccgcttgaaggaggtctgtcccaacagcagcgccagc
gcggcagttgctgcacccaccctcccagcccacccatccacattcactcagcctcagaga
cgagtggacaccctgaactcggacggatacacccctgaaccagcacgcttagcgtcatcg
acagacaagccccggccgatgcccatggacacaagtgtgtacgagagtccctacagcgac
cctgaggaactcaaagacaagaagctcttcctgaagcgagagaatctcctcgtggcggac
atcgagcttggctgtggcaactttggctccgtgcgccagggagtctatcgcatgcgcaag
aagcagattgacgtggccatcaaggtgctgaagcagggcacagagaaggccgacaaagat
gagatgatgcgagaggcccagatcatgcaccagctcgacaacccctacatcgtgcggctc
atcggcgtgtgccaggcagaagcactcatgctggtcatggagatggcgggaggcgggccc
ctgcacaagttcctgctgggaaagaaggaggagatccctgtgagcaatgtggctgaactg
ctgcaccaggtggccatgggcatgaagtatttggaggagaaaaactttgtgcaccgcgac
ctggcagcccgcaatgttctactggtcaatcggcactatgccaagatcagcgactttggc
ctgtccaaagccctgggtgctgacgacagctattacacagcccggtctgcagggaagtgg
cctctgaagtggtacgcgccagagtgcatcaactttcggaagttctccagccgcagtgac
gtctggagctatggggtcaccatgtgggaggccttctcctatggccagaagccctacaag
aaaatgaagggccccgaggtcctggacttcatcaagcagggtaagaggatggaatgtccg
ccggagtgtcctcctgagatgtatgcacttatgagtgactgctggatctacaagtgggag
gatcgccccgacttcctgactgtggaacaacgtatgcggaactattactacagcctggcc
agccgggccgagggacccccacagtgtgaacaggtggccgaggctgcatgtggctga

DBGET integrated database retrieval system