KEGG   Mus musculus (mouse): 226413Help
Entry
226413            CDS       T01002                                 

Gene name
Lct, Gm100, LAC, LPH, Lphl
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu01100  Metabolic pathways
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    226413 (Lct)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    226413 (Lct)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     226413 (Lct)
    3.2.1.108  lactase
     226413 (Lct)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   226413 (Lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 226413
NCBI-ProteinID: NP_001074547
MGI: 104576
Ensembl: ENSMUSG00000026354
Vega: OTTMUSG00000030320
UniProt: F8VPT3
LinkDB All DBs
Position
1 E3; 1 55.8 cM
AA seq 1931 aa AA seqDB search
MELPWTALFLSTFLLGLSCQGNDWESDRNFISAAGPLTNDLVHNLNHPLGKQGSDLVAGD
TDIYVCQQPLPSFLPQYFSSLRASQVTHYKVLLSWAQLLPKGSSKNPDQEAVQCYRQLLQ
SLKDAQLQPMVVLFHQMPPTSTIQRDGGFADLFADYATLAFQSFGDLVEIWFTFSDLEKV
IMGLPHQHLKASGLQTLSDAHRKAFDVYHRKYSSQGGKLSVVLKAEDLPKLLPDPSSAAL
VKGSVDFLSLDLSYDCQSISTLPQKLSELQNLEPKVKVFVYTLKPQDCPSTGMSPASLLF
RLLEAINKDQVQTVGFDVSAFLSCTSSSEESPSCSLTYSSLALQSEQQHETVVSSFPGSA
YQRVWAALANQSREERDAFLQDVFPEGFLWGVSTGAFNVEGGWAEGGRGPSIWDHYSNLN
AAESQATAKVASDSYHKPVSDVALLRGLRADVYKFSISWSRIFPFGQRTSPNLQGVAYYN
KLIDSLLDSQVEPMATLFHWDLPQALQEQGGWQNESVVDAFLDYAAFCFSTFGDRVKLWV
TFHEPWVISYAGYGTGQHAPAISDPGVASFKVAHLILKAHARTWHHYNYHHRQKQQGRVG
IVLNSDWAEPLDGKSPQDLAAAERYLHFMLGWFAHPIFIDGDYPAALRAQIQHTNQQCGR
PLAQLPEFTEAEKRLLKGSADFLGLSHYTSRLISKAGQQTCIPSYDNIGGFSQHVDPKWP
QTASPWIRVVPWGIRRLLRFASLEYTKGKLPIFLAGNGMPIGEGSDLFDDSMRVNYLNLY
INEVLKAVKEDSVDVRSYIARSLIDGYEGPLGYSQRFGLYHVNFNDSSRPRTPRKSAYFF
TSIIEKNGFPAKKVKRNPLPLKADFSSRARAAFSFPSEVPSKAKVVWEKFSRQPKFERDL
FYHGTFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGNGVKDNATGDIACDSYH
QLDADINILRTLKVKSYRFSISWPRIFPTGRNSSINKQGVDYYNKLIDRLLESNIFPMVT
LFHWDLPQALQDIGGWENPSLIELFDSYADFCFKTFGDRVKFWMTFNEPWCSAVLGYSSG
IFPPNVQDPGSLSYKVSHVIIKAHARVYHTYDEKYRQEQKGVISLSLNTHWVEPKDPGVQ
RDVEAADRMLQFNLGWFAHPIFKNGDYPDVMKWNVGNRSELQHLASSRLPSFTEEEKNYI
RGTADVFCINTYTSVFAQHVTPRLNPPSYDNDMELKASDMNSSALISMMHQDVPWGMRRL
LNWIKEEYGNIPIYITENGQGLTNPTLDDTERIFYHKTYINEALKAYRLDGVDLRGYSAW
ALMDNFEWLHGYTMRFGLYHVDFDHVNRPRTARASARYYTEVITNNGMPLAKEDEFLYGE
FPKGFIWSAASASYQVEGAWRADGKGLSIWDTFSHTPLKIGNDDNGDVACDSYHKIAEDV
VALQNLGVSHYRFSISWPRILPDGTTKFINEAGLNYYVRFIDALLAAGITPQVTMYHWDL
PQALQDVGGWENETVVQRFKDYADVLFRRLGDKVKFWITLNEPFVIAAHGYGSGVSAPGI
SFRPGTAPYTAGHNLIKAHAEAWHLYNSTYRNSQGGVISITISSDWAEPRDPSNQEDVEA
ARRYVQFMGGWFAHPIFKNGDYPEVMKTRIRDRSLAAGLNKSRLPEFTESEKKKIQGTFD
FFGFNHYTTVLAYNLNYAAAVSSFDADRGVASITDRSWPDSGSFWLKMTPFGFRRILNWL
KEEYNNPLIYVTENGVSRRGDPELNDTDRIYYLRSYINEALKAVRDKVDLRGYTVWSIMD
NFEWATGFAERFGVHFVNRSDPSLPRIPKASAKVYASIVRCNGFPDPAQGPHPCLQQPED
AGPTASPVKSEVPFLGLMLGTAEAQTALYVLFALVLLGVCSVAFLLYKYCKRSKQGTTQP
GHHGLSQISSF
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atggagctgccttggacagcactcttcctcagtaccttcctcctgggtctttcatgccag
gggaatgactgggaatctgacagaaattttatttcagctgctggtcctctaacaaatgac
ttagtgcacaatctgaaccatccgctgggaaagcagggctctgatttggtagctggtgat
actgacatctatgtctgccagcagccactgccctccttcttgcctcagtacttcagcagt
cttcgggccagccaggttacccattacaaagtacttctgtcatgggcacaacttctccca
aaaggaagctccaagaatccagaccaggaagcagtgcagtgctaccgacaactcctccag
tccctgaaggatgcccagcttcagcccatggtggtcctgttccaccagatgccacctacc
agcaccatccagagagacgggggctttgctgacctctttgctgattatgccacattggct
tttcagtcctttggggaccttgttgagatctggttcaccttcagtgacttggagaaagtg
atcatgggtcttccccaccagcatttgaaagcttctggtctccaaaccctcagcgatgcc
cacaggaaagcctttgacgtttaccacagaaagtactcttctcagggaggaaagctgtct
gtggtcctgaaggctgaagacctccccaagcttctgccagacccatcctcagcggctctc
gtcaagggctccgtggatttcctctctcttgatttgtcttatgactgccaaagtatatcg
actctaccacagaagctgagtgaattgcagaaccttgagcccaaagtgaaagttttcgtc
tacaccctaaaacctcaggactgcccatcgactggaatgagccccgcctcactgctcttc
agactcctggaagccataaataaagaccaagtccagactgttgggtttgatgtcagtgcc
ttcctgagctgtacgtccagttctgaggagagcccatcttgttctttaacctacagtagc
ctggcccttcagagcgagcagcagcatgagacagttgtgtcctcattccctgggtcggcc
taccagagagtctgggcagccttggctaaccagtctagggaggaaagggacgctttcctg
caagatgtatttccagaagggttcctctggggcgtatccacgggagcctttaacgtggaa
ggaggctgggccgaaggtggcagagggccaagcatctgggaccactacagtaacctgaat
gctgcggagagccaagcgacagcaaaggtggccagtgacagttaccacaaaccagtttct
gatgtggccctcctccgaggcctcagggctgacgtgtacaaattctccatctcctggtcc
cgcatcttccctttcgggcagaggaccagccccaacctccaaggtgttgcctactacaac
aaactgattgacagcctgctggactcccaggtggagcccatggctacgctgttccactgg
gacctcccccaggccctgcaggagcaaggcgggtggcagaacgagagtgtggtggatgcc
ttcctggactacgccgccttctgcttctccacctttggggaccgtgtgaagctgtgggtg
accttccatgagccctgggtgataagctatgcaggctacggcaccgggcagcatgcgcca
gccatctctgacccaggagtggcttcctttaaggtggctcacctgatcctcaaggcgcat
gccagaacttggcatcactacaactatcaccatcgccaaaagcagcagggacgcgtgggc
attgtgctcaattcagactgggcggagcccctggacgggaagagcccgcaggaccttgct
gctgccgagcgctacctgcacttcatgctaggctggtttgcacaccccatcttcatagat
ggggactaccctgctgcccttcgggcccagatccagcacacaaaccagcagtgtggccgt
cctctggcccaactcccagagttcactgaagcagagaagcggctcctgaaaggctctgcg
gatttcctaggtctgtctcattacacatcccgcctcatcagcaaggccgggcagcagacc
tgcatccccagctatgataacatcggaggcttctcccagcacgtagatcccaagtggccc
cagaccgcatcgccctggatccgagtggtgccctggggcataaggaggctgcttcggttc
gcttccctggaatacacgaaaggaaaacttccaatcttcttggctggaaatggcatgcca
ataggggaagggtcggatctgtttgatgactcaatgagagtaaactacttaaacttgtac
atcaacgaggtgctcaaggctgtcaaagaggattcagtggatgtccgttcatacattgct
cgttccctcattgatggctatgaaggacccctgggctatagccagaggtttgggctatac
catgtcaacttcaatgacagcagcaggccacgaactcccaggaaatctgcctacttcttc
accagcatcattgaaaagaacggttttcctgccaagaaagtcaaaagaaacccactaccc
ttgaaagcagacttcagctccagagccagggctgccttcagctttccatcggaggtgccc
tccaaggctaaagtagtgtgggagaagttctccaggcagcccaagtttgaaagagactta
ttctatcatggcacattccgggatgacttcctgtggggcgtatcctcttcagcctatcaa
atcgaaggaggttgggatgctgatggcaaaggccccagcatctgggataacttcacgcac
accccagggaacggtgtgaaagacaatgccacgggagacatagcgtgtgacagctatcat
caactggacgctgacataaacatccttcgaactctgaaggtcaagtcctatcgattttcc
atctcctggcctcgaattttcccaacgggaagaaacagttccatcaacaaacaaggtgtt
gattattacaacaaactgattgacagattgttggagagcaacatcttccccatggtgaca
ctctttcactgggacctgccccaggccctccaggatattggaggttgggagaacccttct
ttgattgagttgttcgatagctatgcggacttctgttttaagacctttggtgacagagtc
aagttctggatgacctttaatgagccttggtgttctgcagtgttaggctacagttcaggg
atattccccccaaatgtgcaggacccgggctcactatcttacaaggttagccatgtaatc
attaaggcacacgccagagtctaccatacttatgatgagaagtacaggcaggagcagaag
ggggtcatctctctgagcctcaacactcactgggtcgaacccaaggacccgggggtccaa
agggacgtggaagccgctgaccggatgctgcagtttaacctgggctggtttgcccaccct
atttttaaaaacggggactatccagatgtcatgaaatggaatgtggggaacaggagtgag
ctgcagcacctggccagctcccgcctgcccagcttcacagaagaggagaagaattacatc
agaggcaccgccgatgtcttctgcatcaacacctacacctctgtatttgcacagcatgtc
actcctagactgaacccacccagctatgataatgacatggagttaaaggccagtgacatg
aactcttcagccttgatctccatgatgcaccaagacgtgccctgggggatgaggaggttg
ctgaactggatcaaggaggagtatggcaacattcccatttacatcactgagaatggacag
gggctgacaaaccccacgctggatgacacggaaaggatattctaccacaaaacctatatt
aatgaggctctgaaagcctacaggctggatggtgttgaccttcgaggctactctgcctgg
gcgctgatggacaacttcgagtggctgcacggctacaccatgagatttggattgtatcac
gtcgactttgatcatgtgaacagacctcgaacagcaagagcctcagccagatactataca
gaggtcattaccaacaatggcatgcccctagccaaggaggatgagttcctgtatggagag
tttcccaagggcttcatctggagtgcagcgtctgcttcctatcaggttgaaggtgcgtgg
agagcagatggcaaaggacttagtatctgggacacattttcccacactccactgaagatt
gggaatgacgacaacggggacgtggcatgtgacagttaccacaagattgctgaggatgtg
gtggcccttcagaacctgggcgtgtcccactaccgcttctccatctcctggcctagaatc
ctccccgacggaaccaccaagttcatcaacgaagcaggcctcaactactatgttcgattc
atagatgcgctgctggctgctggcatcacaccacaggtgaccatgtatcactgggacctg
ccccaggcactgcaggacgttgggggctgggagaacgagacagttgtacagcggtttaag
gactatgccgatgtgctcttccggaggttgggggacaaggtcaagttctggatcacactg
aatgagccctttgtcattgcggcccacggctacggcagtggggtgtctgctccagggatc
tctttcagacctggcacagctccgtacactgctggacacaacctaataaaggctcacgct
gaggcttggcatctctacaacagcacataccgtaacagccagggaggtgtgatctctatc
accatcagcagcgactgggccgagcccagagatccttccaaccaggaggatgtggaggcg
gccaggagatacgtacagtttatggggggctggtttgcacaccccatcttcaaaaacgga
gactaccctgaggtgatgaagacacggattcgtgacagaagcctggcggcaggcctcaac
aagtccaggctccctgaatttacagagagcgagaagaagaagatccagggcacctttgac
ttttttgggttcaaccactacaccactgtcctagcctacaacctcaactacgccgctgct
gtttcgtcttttgatgccgataggggagttgcttccattacagaccgctcctggccagac
tctggctccttctggctgaagatgaccccttttggcttccggaggatcttgaactggttg
aaggaggagtacaacaaccctctaatttatgtcacagagaatggagtgtcccgacgagga
gacccagaactcaatgacaccgacaggatctactacctccgcagctacattaatgaagcc
ctcaaagctgtacgagataaggtggaccttcgagggtacacggtctggagcatcatggac
aactttgaatgggccacaggcttcgcagagaggttcggcgtgcactttgtgaaccgctct
gacccttctttgccaaggatccccaaggcgtcagccaaggtctacgcctccatagtccgc
tgcaatggctttcctgaccctgcacaaggacctcatccttgtctccagcaaccagaagat
gctgggcccactgccagccctgtgaagtcagaggtgcccttcctggggctgatgctgggc
acggcagaagcacagacggctctgtatgtcctcttcgctcttgtgctgcttggagtttgc
agcgtggcatttctgttatacaaatactgcaagcgctccaagcaagggacaacacagcca
ggccaccacggtctgagtcaaatttcttccttctga

DBGET integrated database retrieval system