KEGG   Mus musculus (mouse): 227120Help
Entry
227120            CDS       T01002                                 

Gene name
Plcl1, C230017K02Rik, PLC-L, PLC-L1, PLCE, PLCL, PLDL1, PRIP, PRIP-1
Definition
(RefSeq) phospholipase C-like 1
  KO
K15375  inactive phospholipase C-like protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    227120 (Plcl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    227120 (Plcl1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     227120 (Plcl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_12 C2 EF-hand_like PH_14 PH EF-hand_7 Mcp5_PH
Motif
Other DBs
NCBI-GeneID: 227120
NCBI-ProteinID: NP_001108135
MGI: 3036262
Ensembl: ENSMUSG00000038349
Vega: OTTMUSG00000046977
UniProt: Q3USB7
LinkDB All DBs
Position
1; 1 C1.2
AA seq 1096 aa AA seqDB search
MAEGAASREAPAPLDVAGGEDDPRAGADAASGDAPPPALGGRMRDRRSGVALPGAAGVPA
DSEAGLLEAARATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSAHDCISFMQAGC
ELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNG
LADQICEDCAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLDFIEGNQNTP
RFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVT
EEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRR
YELSEDGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIE
DQFRGPADINGYVRALKMGCRSIELDVSDGPDNEPILCNRNNMAMHLSFRSVLEVINKFA
FVASEYPLILCLGNHCSLPQQKVMAQQMKKVFGEKLYTEAPLSSESYLPSPEKLKNMIIV
KGKKLPSESDLLEGEVTDEDEEAEMSRRMSGDYNGEQKHIWLCRELSDLVSICKSVQHRD
FELSMKTQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDF
WNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVS
PLVLHIKIISGQNFPKPKGACAKGDVIDPYVCVEIHGIPADCCEQRTKTVQQNSDNPIFD
ETFEFQVNLPELTMVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHV
TLFVHIAITNRSGGGKPQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAID
MRENMQNAIVSVKELCGLPPIASLKQCLLTLSSRLITSDSTPSVSLVMKDCFPYLEPLGA
IPDVQKRMLAAYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRK
LNKAIESFAWNITVLKGQGDLLKNAKNEAVENIKQIQLACLSCGLSKGPGGGSEAKGKRS
LEAIEEKESSEENGKL
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggcgcggctagcagggaggctccggcgcctctcgacgttgccgggggcgaa
gacgacccccgagccggcgccgacgctgcctcaggggacgccccacccccggccttgggg
ggccggatgagggaccgtcgcagtggggtcgcgctgccgggcgctgcgggggtccccgcg
gatagcgaggccggcctcctggaggctgcacgagcgaccccccggcgtagcagcatcatc
aaggatccttcaaaccaaaaatgtggtggcagaaagaaaacagtgtctttcagtagcatg
ccatcggagaagaagattagcagtgcccacgactgcattagcttcatgcaggctggctgc
gagctgaagaaagtgcgcccgaactctcgcatctacaaccgatttttcaccctagatacc
gacctccaggctctacgctgggaaccttccaagaaagaccttgaaaaagccaagctggac
atttctgccatcaaagagatcaggctggggaagaacacagagacattcagaaacaatggc
cttgctgaccagatctgtgaagactgtgccttctccatactccatggggaaaattacgag
tctctggacctagttgccaattcagcagatgtggcaaacatctgggtgtcggggttacgg
tacctggtctctcgtagtaagcaaccgcttgattttatagagggtaaccagaacacacca
cggttcatgtggctgaaaacggtgtttgaagcagcagatgttgatggaaatgggattatg
ttagaagacacttcagtggagttaataaaacaactcaaccctactctgaaggaatctaag
atcaggttaaaatttaaagaaatccagaagagcaaagaaaaactaactacccgggtgaca
gaagaggaattttgtgaagcattttgcgaactgtgcaccaggccagaagtgtacttctta
cttgtccagatatctaagaacaaagagtacctggatgccaatgacctcatgctcttctta
gaagctgagcaaggtgtcacccacatcactgaggatatgtgtttagacatcattaggaga
tatgagctctctgaagatggccgccagaaaggcttccttgcaattgatgggtttacccag
tatttattgtctccagaatgtgacatttttgatccagagcaaaaaaaagttgcccaagat
atgacccaacccttatctcactactatatcaatgcgtctcataatacctacctgatagaa
gatcagttcaggggaccagcagatatcaatgggtatgtgagagcattgaagatgggctgt
agaagcattgagctcgatgtgagtgatggtccggataatgagcccatcctttgtaatagg
aacaacatggccatgcacctttcctttcgaagtgttctggaggtgataaataagtttgcc
tttgttgcttcagagtacccactcattctctgcttggggaatcactgctctctgcctcag
cagaaagtcatggcacagcagatgaaaaaggtgtttggcgagaaactttatacagaagca
cctttgtcttcagaatcctacctcccatcacctgaaaaactaaaaaatatgattattgtg
aaaggaaagaaattgccttcggaatcagatctgttagaaggagaagtgaccgacgaggac
gaagaagccgagatgtcgcggaggatgtcaggggattacaacggtgagcagaaacatatc
tggctctgccgagagctctctgacttggtatccatctgcaaatctgttcagcacagggat
tttgaactgtctatgaaaacccaaaactactgggaaatgtgttcatttagtgaaacagag
gccagccggattgccaatgaatacccagaggacttcgtgaattataacaagaagttctta
tcaagggtctaccctagtgccatgcggatagattccagtaatttgaacccacaggacttc
tggaactgtggctgtcagattgtggcgatgaattttcaaactcccggtccaatgatggac
ctccacactggctggtttcttcaaaatggaggatgtggctacgtcctcaggccatctatc
atgcgagatgaagtttcgtacttcagcgcaaatacaaagggcattgtccctggcgtgtct
cccctggttcttcacatcaagatcatcagtggtcagaacttcccaaagcccaaaggagcc
tgtgccaaaggggatgtcatagacccctatgtttgtgtggagattcacggaattccagct
gattgctgcgagcaaagaactaaaactgtacaacagaacagcgataatccaatttttgat
gaaactttcgagtttcaagtcaaccttcccgagctgaccatggtccgttttgtcattttg
gatgatgattatattggggatgagttcattgggcagtatacgatcccatttgaatgtctg
cagcccgggtaccggcacgttcccttgcgctcctttgttggggatatcatggagcacgtg
acccttttcgttcacatagcaataaccaatcgcagtggaggaggaaaaccacagaagcga
agcctttctgtgagaatggggaagaaagttcgagaatacaccatgctcaggaatattggt
cttaaaaccatagatgatatcttcaaaatagcagttcatcccttacgagaagccatagat
atgagagaaaacatgcagaacgccatagtgtctgttaaggagctgtgtggactcccgccg
attgccagtctgaaacagtgcctgttaaccctgtcctctcgtctcatcaccagtgacagt
actccctctgtgtctctggtgatgaaggactgctttccttacctggagcctctgggtgcc
attccagatgtgcagaagaggatgctggctgcatatgatctgatgattcaagagagccgg
gtcctcatagaaatggctgacacagttcaggaaaagattgtacagtgtcagaaagcaggg
atggaattccatgaggaacttcataatctgggggcaaaggaaggcttgaagggaagaaaa
ctcaacaaggccattgagagcttcgcttggaatattacggtattgaagggacaaggagac
ctgctgaagaatgccaagaatgaagccgtggagaacataaagcaaatccagctggcctgc
ttgtcttgtggactgagtaaaggccctggcggtggctcagaggccaagggcaagcgcagc
ttggaagcgatagaggagaaagaaagtagtgaggagaacgggaagctgtga

DBGET integrated database retrieval system