KEGG   Mus musculus (mouse): 22773Help
Entry
22773             CDS       T01002                                 

Gene name
Zic3, Bn, Ka
Definition
(RefSeq) zinc finger protein of the cerebellum 3
  KO
K18487  zinc finger protein ZIC 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22773 (Zic3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22773 (Zic3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    22773 (Zic3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_4 zf-met zf-C2H2_6 zf-C2H2_8 Zf_RING
Motif
Other DBs
NCBI-GeneID: 22773
NCBI-ProteinID: NP_033601
MGI: 106676
Ensembl: ENSMUSG00000067860
Vega: OTTMUSG00000017528
UniProt: Q62521
LinkDB All DBs
Position
X A6; X 32.56 cM
AA seq 466 aa AA seqDB search
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSP
ATAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHASQVPTYGGAASAAFNSTRDFLFR
QRGSGLSEAASGGGQHGLFAGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVDN
NQVHLGLRGELFGRADPYRPVASPRTDPYAASAQFPNYSPMNMNMGVNVAAHHGPGAFFR
YMRQPIKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEE
CPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCE
FEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPAA
SSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgctcctggacggaggcccgcagttccctgggttgggagtgggcagcttcggt
gctccgcgccaccacgagatgcccaaccgcgagcctgcaggcatgggattgaatcccttc
ggggactcaacccacgctgcggccgccgccgctgccgccgctgccttcaagctgagccca
gccaccgctcacgatctgtcttcgggccagagctcagcgttcacaccgcagggttcaggt
tatgccaatgccctgggccaccatcaccaccaccatcaccaccatcacgccagccaggtg
cccacctacggcggcgctgcctccgccgctttcaactccacgcgcgactttctgttccgt
cagcgcggttctgggctcagcgaggcagcctccgggggcgggcagcacgggcttttcgct
ggctcggcgagcagtcttcacgctccagctggtattcctgagcctcctagctacttgctc
tttcctgggcttcatgagcagggcgctgggcacccgtcgcccacagggcacgtggacaac
aaccaggtccatctggggctgcgcggggagctatttggccgtgcagacccataccgcccc
gtggctagcccgcgcacggacccctacgcggccagtgcgcagttccctaactatagcccc
atgaacatgaacatgggcgtgaacgtggcggcccaccacgggccgggcgccttcttccgt
tacatgcggcagcccatcaagcaggagctgtcctgtaagtggatcgaggaggctcagctg
agccggcccaagaagagctgcgaccggaccttcagcaccatgcatgagttggttacgcat
gttaccatggagcatgtggggggcccggagcagaacaaccacgtctgctattgggaggaa
tgtccccgcgaaggcaagtccttcaaggcgaagtacaaactggtcaaccatatccgagtg
cacactggcgagaaacccttcccgtgtcccttcccgggctgcgggaagatttttgcccgc
tctgagaacctcaagatccacaagaggacccatacaggtgagaaacctttcaaatgtgaa
ttcgaaggctgtgacagacggtttgccaacagcagcgaccgcaagaagcacatgcatgtg
cacacctcggacaagccctatatctgtaaagtgtgcgacaagtcctacacacacccgagc
tccctgcgcaaacacatgaaggttcatgaatctcaagggtcagattcctcccctgctgcc
agttcaggctatgaatcttccactccacccgctatagcttctgcaaacagtaaagatacc
actaaaaccccttctgcagttcaaactagcaccagccacaaccctggacttcctcccaat
tttaacgaatggtacgtctga

DBGET integrated database retrieval system