KEGG   Mus musculus (mouse): 228607
Entry
228607            CDS       T01002                                 

Gene name
Mavs, D430028G21Rik, IP, IPS-1, Visa, cardif
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    228607 (Mavs)
   04622 RIG-I-like receptor signaling pathway
    228607 (Mavs)
   04623 Cytosolic DNA-sensing pathway
    228607 (Mavs)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    228607 (Mavs)
   05160 Hepatitis C
    228607 (Mavs)
   05171 Coronavirus disease - COVID-19
    228607 (Mavs)
   05164 Influenza A
    228607 (Mavs)
   05162 Measles
    228607 (Mavs)
   05168 Herpes simplex virus 1 infection
    228607 (Mavs)
   05169 Epstein-Barr virus infection
    228607 (Mavs)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 228607
NCBI-ProteinID: NP_001193314
MGI: 2444773
Ensembl: ENSMUSG00000037523
Vega: OTTMUSG00000016041
UniProt: Q8VCF0 Q3U5B1
LinkDB
Structure
PDB: 
4GHU

Position
2; 2 F1
AA seq 503 aa
MTFAEDKTYKYIRDNHSKFCCVDVLEILPYLSCLTASDQDRLRASYRQIGNRDTLWGLFN
NLQRRPGWVEVFIRALQICELPGLADQVTRVYQSYLPPGTSLRSLEPLQLPDFPAAVSGP
SAFAPGHNIPDHGLRETPSCPKPVQDTQPPESPVENSEQLLQTNSGAVARMSGGSLIPSP
NQQALSPQPSREHQEQEPELGGAHAANVASVPIATYGPVSPTVSFQPLPRTALRTNLLSG
VTVSALSADTSLSSSSTGSAFAKGAGDQAKAATCFSTTLTNSVTTSSVPSPRLVPVKTMS
SKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPANTIPPERNSKQ
AKETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPS
SSLVSEPNHGPEENEYSSFRIQVDESPSADLLGSPEPLATQQPQEEEEHCASSMPWAKWL
GATSALLAVFLAVMLYRSRRLAQ
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgacatttgctgaggacaagacctataagtatatccgagacaaccacagcaagttttgc
tgtgttgacgttctggagatcctgccttacctgtcctgcctcacagctagtgaccaggat
cgactgcgggcttcctacaggcagatcgggaaccgggacacactctggggactcttcaat
aatctccagcgccggcctggctgggtggaggtcttcatccgggcactgcagatctgtgag
ctgcctgggctggctgatcaagtgactcgagtttatcagagctacctgcctccggggacc
tcactccgctccctagagccactgcagttaccagactttcctgctgcggtttctggaccc
tctgcatttgcgccaggtcacaacatccctgaccatggcttacgagagacaccaagttgc
cccaagcctgtccaggacacccagccaccagagtccccagtagagaattcagagcaactc
ctccagaccaactccggggccgtcgcgaggatgtctggtggctctttgataccctctcct
aaccagcaggctctcagccctcagccctccagagagcatcaagagcaagaaccagaactg
ggtggcgcccacgcagcaaatgttgcctctgttcccatagcaacctatggacctgtgtct
ccaaccgtttccttccagccccttccacgtactgccctgaggacaaacctcttgtctggg
gtcacagtatcagccctatctgctgatacctctttgtcctcctcgtccactggatcagct
tttgcaaagggagctggtgaccaggccaaagctgccacctgtttcagtactacactcacc
aattctgtgactaccagctcagtgccttctcccagattggtcccagtaaaaaccatgtct
tccaagttgcccctcagttcaaagtccactgctgcgatgacgtctactgtgctcaccaat
acagcgccatcaaaattacccagcaactcagtgtatgcgggcacagtgccatccagagtg
cctgctagtgtggccaaagcacctgccaacacaataccacctgagaggaacagcaagcaa
gccaaggagaccccggagggtccagcaaccaaagtcaccactggaggcaaccagactgga
ccaaatagcagtatcaggagcttgcactctggaccagagatgagcaagccaggtgtgctg
gtatcccagttggacgagccattctcagcctgctctgtggaccttgccattagccctagc
agctccttggtctcagaacccaaccatggtccagaggagaatgagtattcgtcctttaga
atccaggtagacgaaagccccagtgctgatctattaggaagccctgagccactagccacc
cagcagccccaagaagaggaagaacattgtgccagttcaatgccctgggctaagtggctt
ggggccaccagtgcactcttggctgtattcctggcagtgatgctgtaccgtagtaggcgc
ctggcccagtga

DBGET integrated database retrieval system