KEGG   Mus musculus (mouse): 230075Help
Entry
230075            CDS       T01002                                 

Gene name
Ndufb6, CI-B17, Gm137
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    230075 (Ndufb6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    230075 (Ndufb6)
  09159 Environmental adaptation
   04714 Thermogenesis
    230075 (Ndufb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    230075 (Ndufb6)
   05012 Parkinson disease
    230075 (Ndufb6)
   05016 Huntington disease
    230075 (Ndufb6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    230075 (Ndufb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B6 Sensor
Motif
Other DBs
NCBI-GeneID: 230075
NCBI-ProteinID: NP_001028477
MGI: 2684983
Ensembl: ENSMUSG00000071014
Vega: OTTMUSG00000006581
UniProt: Q3UIU2 A2AP31
LinkDB All DBs
Structure
PDB: 

Position
4; 4 A5
AA seq 128 aa AA seqDB search
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNM
VFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPM
RDFPDQHH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggtacacgccggatgagaagctgcggctgcagcagctgcgggagctaaggaga
cgatggctgaaggaccaggagctgagtccccgggagcccgtgttgcccccgcgcaggatg
tggcccctggagcgattctgggataactttttgcgggacggggccgtgtggaagaacatg
gtctttaaggcgtaccgctccagtctcttcgctgtttctcatgtgcttatacctatgtgg
tttgttcactattatgtcaaatatcatatggctactaaaccatacaccattgttagctcg
aagcccaggatatttccaggtgatacaattctggagactggagaagtaattccaccaatg
agagattttcctgatcaacatcattga

DBGET integrated database retrieval system