KEGG   Mus musculus (mouse): 232223Help
Entry
232223            CDS       T01002                                 

Gene name
Txnrd3, AI196535, TGR, TR2
Definition
(RefSeq) thioredoxin reductase 3
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    232223 (Txnrd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    232223 (Txnrd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    232223 (Txnrd3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     232223 (Txnrd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Glutaredoxin Pyr_redox_3 FAD_binding_2 Thi4 AlaDh_PNT_C HI0933_like FAD_oxidored DAO NAD_binding_8 GIDA FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 232223
NCBI-ProteinID: NP_001171529
MGI: 2386711
Ensembl: ENSMUSG00000000811
Vega: OTTMUSG00000021186
UniProt: Q99MD6
LinkDB All DBs
Structure
PDB: 

Position
6; 6 D1
AA seq 652 aa AA seqDB search
MEKPPSPPPPPRAQTSPGLGKVGVLPNRRLGAVRGGLMSSPPGRRARLASPGTSRPSSEA
REELRRRLRDLIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQEVL
TEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQDDSAHDYDLIIIGGGSGGLSC
AKEAANLGKKVMVLDFVVPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGHALQDAKKYG
WEYNQQVKHNWEAMTEAIQSHIGSLNWGYRVTLREKGVTYVNSFGEFVDLHKIKATNKKG
QETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGCTLVVGASYVGLECAG
FLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGKL
KVVAKSTEGPETVEGIYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVP
HVYAIGDILDGKPELTPVAIQAGKLLARRLFGVSLEKCDYINIPTTVFTPLEYGCCGLSE
EKAIEMYKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKFDNERVVGFHLLGPNAGE
ITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
ctggagaagccaccgtccccgccgccgcctcctcgggcgcagacctcgcccgggctgggg
aaggttggagtcctccccaaccgccgcctgggtgctgtccgtggcggcctcatgtcgtcg
ccacccggccgccgcgcccgcctggcctcccctgggaccagccgcccgtcttctgaggcc
cgcgaggagctgcggcgccgcctgcgggacctcatcgagggcaacagggtgatgatcttc
agcaagagttactgtccacacagcacgcgggttaaggaactcttttcgtccttgggagtg
gtctataacatcctggaacttgatcaagttgatgacggggccagtgttcaggaagtgctg
acagaaatcagtaaccagaaaacggtgcccaatatttttgtgaataaagtgcacgtgggt
ggatgtgaccgaactttccaggcacatcagaatggtttactgcagaagctcctccaagat
gactcggctcatgattacgacctcatcatcatcggcgggggttctggcggcctctcttgt
gccaaggaagctgccaacttgggaaagaaggtcatggtgctagactttgtggtcccatcg
cctcagggcacgacctggggccttggcggcacctgtgtgaacgtaggctgtattccaaag
aagctgatgcatcaggcagccctcctggggcatgctttgcaagatgccaagaaatatggc
tgggagtataaccagcaggtgaagcacaactgggaggccatgacagaagctatccagagc
cacattggctccttgaactggggctacagggtaacccttcgggagaaaggcgtgacctat
gtcaactccttcggggagtttgtggacctgcataaaataaaggcaaccaataagaaaggg
caggaaacgttttacacggcttcgaagtttgtcatagcaacaggtgaaaggcctcggtac
ttgggaatccagggagataaagagtactgtattacgagtgacgacctgttctctctgcca
tactgcccgggatgtacattagtcgtaggcgcttcttatgttggtctggagtgtgcgggc
tttttggctggtttggggttagatgtgacagtcatggtacgctccgtccttcttcgtggc
tttgatcaagaaatggcagagaaagtgggatcctacctggaacaacaaggtgtcaagttc
caaaggaaattcacccccattttggttcaacagttggagaaaggtttaccaggaaaattg
aaagtcgtggctaagtccaccgaaggaccggaaacagtagaagggatatacaacacggtt
ttgttagcaattggtcgtgactcctgtacaaggaaaatagggctggagaagatcggggtc
aaaatcaatgagaagaatggcaaaataccagtaaacgatgtggagcagaccaacgtgcct
catgtttatgctattggggacatactggacggcaaaccagagctcacccccgttgccata
caggcaggcaagctgctagctcgaagactctttggggtctctttagaaaagtgtgattat
attaacatcccaacaacggtgttcacacctctggaatatggctgttgtggactgtcggaa
gagaaagccatcgaaatgtataaaaaagagaatctggaagtgtatcacaccttgttttgg
cctctcgagtggacagttgctggcagagacaacaacacctgttatgcaaagataatctgc
aacaaattcgacaacgaacgtgtggtgggatttcaccttctggggccaaatgctggtgaa
atcacgcagggatttgcagctgcaatgaaatgtgggctcacgaagcagctactggatgat
accattggaatccaccccacctgtggtgaggtattcacaacattggaaatcacaaagtcc
tcagggctggacattactcagaaaggctgctgaggctag

KEGG   Mus musculus (mouse): 26462Help
Entry
26462             CDS       T01002                                 

Gene name
Txnrd2, AA118373, ESTM573010, TGR, Tr3, Trxr2, Trxrd2
Definition
(RefSeq) thioredoxin reductase 2
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    26462 (Txnrd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26462 (Txnrd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    26462 (Txnrd2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     26462 (Txnrd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 AlaDh_PNT_C K_oxygenase GIDA FAD_oxidored HI0933_like Thi4 NAD_binding_8 DAO
Motif
Other DBs
NCBI-GeneID: 26462
NCBI-ProteinID: NP_038739
MGI: 1347023
Ensembl: ENSMUSG00000075704
Vega: OTTMUSG00000026082
UniProt: Q9JLT4
LinkDB All DBs
Structure
PDB: 

Position
16 A3; 16 11.41 cM
AA seq 527 aa AA seqDB search
MAAMVAAMVAALRGPSRRFRPRTRALTRGTRGAASAAGGQQSFDLLVIGGGSGGLACAKE
AAQLGKKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEV
AQPVQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGGKAT
LLSAEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFL
TGIGLDTTVMMRSIPLRGFDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLQVTWE
DHASGKEDTGTFDTVLWAIGRVPETRTLNLEKAGISTNPKNQKIIVDAQEATSVPHIYAI
GDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPTTVFTPLEYGCVGLSEEEAVA
LHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGF
ALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGCUG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatggtggcggcgatggtggcggcgctgcgtggacccagcaggcgcttccgg
ccgcggacacgggctctgacacgcgggacaaggggcgcggcgagtgcagcgggagggcag
cagagctttgatctcttggtgatcggtgggggatccggtggcctagcttgtgccaaggaa
gctgctcagctgggaaagaaggtggctgtggctgactatgtggaaccttctccccgaggc
accaagtggggccttggtggcacctgtgtcaacgtgggttgcatacccaagaagctgatg
catcaggctgcactgctggggggcatgatcagagatgctcaccactatggctgggaggtg
gcccagcctgtccaacacaactggaagacaatggcagaagccgtgcaaaaccatgtgaaa
tccttgaactggggtcatcgcgtccaactgcaggacaggaaagtcaagtactttaacatc
aaagccagctttgtggatgagcacacagttcgcggtgtggacaaaggcgggaaggcgact
ctgctttcagctgagcacattgtcattgctacaggaggacggccaaggtaccccacacaa
gtcaaaggagccctggaatatggaatcacaagtgacgacatcttctggctgaaggagtcc
cctgggaaaacgttggtggttggagccagctatgtggccctagagtgtgctggcttcctc
actggaattggactggataccactgtcatgatgcgcagcatccctctccgaggctttgac
cagcaaatgtcatctttggtcacagagcacatggagtctcatggcacccagttcctgaaa
ggctgtgtcccctcccacatcaaaaaactcccaactaaccagctgcaggtcacttgggag
gatcatgcttctggcaaggaagacacaggcacctttgacactgtcctgtgggccataggg
cgagttccagaaaccaggactttgaatctggagaaggctggcatcagtaccaaccctaag
aatcagaagattattgtggatgcccaggaggctacctctgttccccacatctatgccatt
ggagatgttgctgaggggcggcctgagctgacgcccacagctatcaaggcaggaaagctt
ctggctcagcggctctttgggaaatcctcaaccttaatggattacagcaatgttcccaca
actgtctttacaccactggagtatggctgtgtggggctgtctgaggaggaggctgtggct
ctccatggccaggagcatgtagaggtttaccatgcatattataagcccctagagttcacg
gtggcggatagggatgcatcacagtgctacataaagatggtatgcatgagggagccccca
caactggtgctgggcctgcacttccttggccccaacgctggagaagtcacccaaggattt
gctcttgggatcaagtgtggggcttcatatgcacaggtgatgcagacagtagggatccat
cccacctgctctgaggaggtggtcaagctgcacatctccaagcgctccggcctggagcct
actgtgactggttgctgaggctaa

KEGG   Mus musculus (mouse): 50493Help
Entry
50493             CDS       T01002                                 

Gene name
Txnrd1, TR, TR1, TrxR1
Definition
(RefSeq) thioredoxin reductase 1
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    50493 (Txnrd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50493 (Txnrd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50493 (Txnrd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     50493 (Txnrd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored Thi4 GIDA DAO NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 50493
NCBI-ProteinID: NP_001035988
MGI: 1354175
Ensembl: ENSMUSG00000020250
UniProt: Q9JMH6
LinkDB All DBs
Position
10; 10 C1
AA seq 613 aa AA seqDB search
MPVDDCWLYFPASRGRTFVQTVWVAPTCPNCCWFPGFLPPVPRPPHVPRVLLRGPRGAVL
PASRPSKTLPSSSQTPCPTDPCICPPPSTPDSRQEKNTQSELPNKKGQLQKLPTMNGSKD
PPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIP
KKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVV
YENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSL
PYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIK
FIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVG
VKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCD
YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKII
CNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTK
RSGGDILQSGCUG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgatgactgctggctgtacttcccagcttctcgaggtagaacctttgtgcag
actgtctgggtggcacccacttgccccaactgttgctggtttccaggttttctccctcca
gtcccccggccaccacatgtgccccgtgtgctgctgaggggccctcgtggggctgtgctt
cctgcttcacgtccctccaagacactcccctcctcatcccagacgccctgtcctactgac
ccctgtatctgccctccaccctccacacctgatagtaggcaggaaaaaaatacgcaatct
gagctgccgaacaaaaaaggccaacttcaaaagctgccaacaatgaatggctccaaagat
ccccctgggtcctatgacttcgacctgatcatcattggaggaggctcaggaggactggca
gcagctaaggaggcagccaaatttgacaagaaagtgctggtcttggattttgtcacaccg
actcctcttgggaccagatggggtctcggaggaacgtgtgtgaatgtgggttgcatacct
aagaagctgatgcaccaggcagctttgctcggacaagctctgaaagactcgcgcaactat
ggctggaaagtcgaagacacagtgaagcatgactgggagaaaatgacggaatctgtgcag
agtcacatcggctcgctgaactggggctaccgcgtagctctccgggagaaaaaggtcgtc
tatgagaatgcttacgggaggttcattggtcctcacaggattgtggcgacaaataacaaa
ggtaaagaaaaaatctattcagcagagcggttcctcatcgccacaggtgagaggccccgc
tacctgggcatccctggagacaaagagtactgcatcagcagtgatgatcttttctccttg
ccttactgcccggggaagaccctagtagttggtgcatcctatgtcgccttggaatgtgca
ggatttctggctggtatcggcttagacgtcactgtaatggtgcggtccattctccttaga
ggatttgaccaagacatggccaacaaaatcggtgaacacatggaagaacatggtatcaag
tttataaggcagttcgtcccaacgaaaattgaacagatcgaagcaggaacaccaggccga
ctcagggtgactgctcaatccacaaacagcgaggagaccatagagggcgaatttaacaca
gtgttgctggcggtaggaagagattcttgtacgagaactattggcttagagaccgtgggc
gtgaagataaacgaaaaaaccggaaagatacccgtcacggatgaagagcagaccaatgtg
ccttacatctacgccatcggtgacatcctggaggggaagctagagctgactcccgtagcc
atccaggcggggagattgctggctcagaggctgtatggaggctccaatgtcaaatgtgac
tatgacaatgtcccaacgactgtatttactcctttggaatatggctgttgtggcctctct
gaagaaaaagccgtagagaaatttggggaagaaaatattgaagtttaccatagtttcttt
tggccattggaatggacagtcccatcccgggataacaacaaatgttatgcaaaaataatc
tgcaaccttaaagacgatgaacgtgtcgtgggcttccacgtgctgggtccaaacgctgga
gaggtgacgcagggctttgcggctgcgctcaagtgtgggctgactaagcagcagctggac
agcaccatcggcatccacccggtctgtgcagagatattcacaacgttgtcagtgacgaag
cgctctgggggagacatcctccagtctggctgctgaggttaa

DBGET integrated database retrieval system