KEGG   Mus musculus (mouse): 232714Help
Entry
232714            CDS       T01002                                 

Gene name
Mgam, 6030407P20Rik, MGA
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    232714 (Mgam)
   00500 Starch and sucrose metabolism
    232714 (Mgam)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    232714 (Mgam)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     232714 (Mgam)
    3.2.1.20  alpha-glucosidase
     232714 (Mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 PagP
Motif
Other DBs
NCBI-GeneID: 232714
NCBI-ProteinID: NP_001164474
MGI: 1203495
Ensembl: ENSMUSG00000068587
Vega: OTTMUSG00000056380
UniProt: B5THE2
LinkDB All DBs
Position
6; 6 B1
AA seq 1827 aa AA seqDB search
MAGRRFKKFSKLELVLIVLLLVLFIIAVVLIVLLANSTPENAIGAETTGTPDTTVTRTTL
NSPNCPVLSELERINCIPDQSSNKGTCDERGCCWDPQGSISVPCYYSRNHGYKMESDVVN
TNAGFTATLKNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFS
GNAPSSLNYKVEVSKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGL
GEHVHQQYRHNMNWKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNA
MEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYD
YKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNNGQK
LVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNC
AVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNNLNYPPFTPKVLDGYLFSK
TLCMDAVQHWGKQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWL
GDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNH
NGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFY
DDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQSIEMQL
PGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVA
QNIYLFSEFSVTQNHLDVTISSPNYKDPNNLEFQEIKIFGTREFRNVRVKQNGNLLQMSP
QVTYNPNLKVATITNIHLRLGEAYTVEWDFFTREEERIDCYPDEHGASEANCSARGCIWE
ASNTTRGPPCYFAHELYSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHK
NEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLIKENPFGIQIRRKTTGTVIW
DSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMNWHTWGMFSRDEPPGYKKNS
YGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVT
QQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQ
LDFKLSPKFSGFPALINRMKANGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNN
GSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQ
DPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMES
EQILPDGSRVRHYDVHNLYGWSQTRPTYEAVQEVTGERGIVITRSTFPSSGRWGGHWLGD
NTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNT
IGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRE
TWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKGVDINATGEWKTLEAPLEY
INLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINTDQYYLA
RFSVNQTTLLTHEKFNNYLTGTAPLYLGYIDIWGLSSSSITNVSISWNTNNEEVFANYNS
TTKILSVNMTDKKISLHTFNSLTWSSS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacggaggtttaagaagttcagcaagctggagcttgttctcattgttctgctg
cttgtcctgttcatcatcgcggtggttctaattgtgctcttagccaactcgactccagaa
aatgccataggtgctgaaacaactggcactccagacactacagtcaccaggaccactctt
aactctcccaattgcccagtgctaagtgagctggaacggataaattgcatccctgaccag
tcatctaacaagggcacatgtgatgagcgaggctgctgctgggatcctcagggatccatc
agtgttccttgctattactccaggaatcatggctacaaaatggagagtgacgttgtaaac
acaaatgcaggattcacagccacactgaaaaacttaccttctgcacccgtgtttggaaac
agcatcgaaaacatcctgcttacagcagagtaccagacatcaaatcgcttccactttaag
ttgactgaccaaaccaagaagaggtacgaagtgccccacgagcacgtgcaacccttcagt
ggaaatgccccttcttccttgaactacaaagttgaggtttccaaggagccatttagcatc
aaagtcaccagaaaaagcaataaccgtgtgctgtttgactcaagtattgggcccctcctc
ttctctgaccagttcctgcagttctctacccacctgccaagtgctaatgtatatggtctg
ggtgaacatgtgcaccagcagtaccgacacaatatgaattggaagacctggcccatgttt
tccagagacacaaccccgaatgaggatggaactaacttgtatggtgtgcagacgttcttc
ctgtgccttgaagataacagtggattgtccttcggggtgtttctgatgaacagcaatgcc
atggaggttactcttcagcctaccccagcaatcacataccgcaccactgggggaattctg
gacttctatgtgttcttggggaacacacctgagcaagttgttcaagaatatctagagctc
attggacggccagctctgccttcatactggacacttgggtttcagctcagccggtatgat
tataaaagcctagataatatgaaagcagttgtggagagaaaccgtgcagcacaactccct
tatgatgttcagcatgctgatattgattatatggatcagaagaaggacttcacttatgac
ccagtgaattttaaaggcttcccagagtttgttaaggagctacacaataatgggcagaaa
cttgttatcattttggatccagcaatttccaacaactctttctcaagtaatccttatggc
ccatatgacaggggttcagcaatgaaaatctgggtgaatagttctgatggcatcagtcca
gtcattggaaaggtctggcctggaacaactgtgtttcctgattacaccagtcccaactgt
gctgtttggtggacaaaagaatttgagcttttccacaaagaagtggagtttgatggaatt
tggattgatatgaacgaagtctccaactttattgatggttcattttctggatgttcccaa
aacaacttgaattatcccccattcacaccaaaagtcctggatgggtacttgttctctaag
actctctgcatggatgccgttcagcactgggggaagcagtatgatgtccacaatctatat
ggctactccatggccattgccacagcaaaagccgtgaaggacgtgttcccagacaagaga
agcttcatcataacccgctctacctttgctggttctggcaaatttgcagcccactggtta
ggagataacaccgccacctggaaggaccttcagtggtccatcccaggcatgcttgagttc
aacctcttcggtatcccaatggtaggggccgatatatgtggctttgcccaagacacatac
gaggagctctgcaggcgctggatgcagctgggggcattttatccattttctcggaatcac
aatggccaaggttacaaggaccaggatcctgcctcttttgggaataactccctgctgttg
aattcgtctaggcactaccttaacatccgctacactttgctgccttacctctacactctt
ttctacagagcacacagccggggagacactgtagctaggcctcttctgcatgagttctat
gacgacaacaatacttggggcatagaccggcaatttctttggggaccaggtcttctcatc
actcctgttctggatcagggtgcagagaaagtgaaagcatatgtgcctaatgccacctgg
tacgactatgaaaccggagaggaactggggtggagaaagcaaagcattgagatgcaactt
cctggagacaagattggacttcaccttcgagggggctacatctttcccacacaacagcct
gccacaaccacagaagccagccggaagaatcctcttggtcttattgtcgccctggatgag
aacaaagaagcaagaggagagctgttctgggatgatggggagtcgaaggatactgtggcc
caaaacatttaccttttcagtgaattttctgtcactcaaaaccatttggatgtgacaatt
tcaagtccaaactacaaggatcccaataacctagaattccaggaaattaaaatctttgga
acacgggaattccgcaatgttagagtgaaacagaatgggaatctccttcaaatgtctcct
caagtcacttacaatccaaacctgaaggttgccaccatcacaaatatccatctcaggctg
ggagaagcgtacacggttgagtgggacttcttcacaagggaggaggaaaggatagattgc
tatccagatgagcatggtgcttctgaggcaaactgcagtgcccgtggctgcatctgggag
gcatccaacactactaggggccctccttgctactttgctcatgagctgtactcagtcagc
aatgttcagtacgactcacatggggccacagctgacatctccttgaaggcttctacttat
agcaatgccttcccctctacacctgtgaataaactgaaactgcaagtgacctatcacaag
aacgaaatgctgcagtttaagatctatgatcccaaccacagtcggtatgaagtcccagtc
cctctgaacatccccagtgctccattgagcacccctgaaggccgtctgtatgatgtcctc
atcaaggagaatccatttgggattcaaattcgccggaagactacaggcactgtaatctgg
gactctcagctcctcggcttcaccttcaatgacatgttcatccgcatctccacccgcctg
ccctccacatacatctatggctttggggaaactgagcacacaaccttcaagatagacatg
aactggcacacatggggcatgttttccagggatgagcccccggggtacaagaagaattct
tatggtgttcacccttactacatggggctggaggaagatggcaatgcccatggagtcctc
ctgatgaacagcaatgccatggatgtgaccttccagcccatgcctgccctgacataccga
accatagggggcattctggacttctatgtgttcttgggcccaactccagagattgttact
caacaatatacagagttgattggtcggcctgtgatggtaccttattggtctctgggattc
cagctgtgtcgctatggatatgagaatgatactgaaattgccaacctgtatgatgaaatg
gtggctaagcagattccctatgatgtgcagtactcagacattgactacatggagaggcag
ctggacttcaagctcagccccaagttctctgggtttccagccctgatcaatcgcatgaag
gccaatgggatgagggtcatcctcattctggatccagccatttctggcaacgagacagag
ccctacccggccttcacccggggtgtggagaatgacgtcttcatcagatatcccaataat
ggaagcattgtctggggaaaggtctggcctgattaccctaatatcactgtggacccttct
ttaggctgggaccatcaagtggagcaataccgagcttatgtggccttcccagactttttc
cgtaattcaactgctacatggtggaagaaggagattaaagaactccacagcaacacacag
gatcctgccaagagcttgaagtttgatggcctgtggattgatatgaatgaaccttccagc
tttgtgaatggggcagttccttctggctgcagcgatgctactctgaaccaccctccctac
atgccatatttggaagccagggacaggggcctgagcagtaagaccctgtgcatggagagt
gagcagatccttccagatggctcccgggtacggcactatgatgtacacaacctgtatggg
tggtcccagaccagacctacctacgaagctgtgcaggaggtgacaggagagagagggatc
gtcatcacacgctccacattcccctcttctggacgctggggaggacactggctgggagac
aacacagctgcctgggaccagctggggaaatccatcattggcatgatggatttcagcctc
ttcggcatatcctataccgggtcagacatctgtgggttctttcaagatgctgagtatgag
atgtgtgttcgctggatgcagctgggcgccttttaccccttctccaggaaccacaacacc
atcgggacccggagacaagaccctgtatcctggaataaaacctttgaggatatttccaga
agtgtgttggaaaccagatacaccctgttgccatatctctacaccttgatgtacaaggcc
cacacggagggcagcacagttgtgaggcctcttctccatgagtttgtgtcagaccgggag
acctggaatatagacaaacagttcctgttgggcccagccttcctagtcagccctgtgctt
gagcctaatgccagaaaggttgaagcatattttcccagggcccgctggtatgactactac
aagggtgtagatatcaatgcaacgggagagtggaagaccttggaagcccctcttgagtac
attaatcttcatattcgtgggggttatattctgccctggcaggaacctgccatgaacacc
catttaagccggcagaagttcatgggcctcagggctgcgttgaatgctgagggacgtgct
gagggctggctcttctgggatgatgggaaaaggatcaataccgatcagtactacttggcc
aggttttctgtcaaccagactacattgctgacgcatgaaaagtttaacaattacctcact
ggcacagcacccttatatctaggctacattgatatctggggattgagcagttcttccatt
accaatgtgagcatctcttggaacactaataatgaagaagtctttgccaactacaactcc
acaaccaagatactgagtgtcaatatgactgacaaaaaaatcagcctgcacactttcaat
tcactgacatggagctcttcataa

DBGET integrated database retrieval system