KEGG   Mus musculus (mouse): 232811Help
Entry
232811            CDS       T01002                                 

Gene name
Kmt5c, BC024816, Suv4-20h2, Suv420h2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    232811 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    232811 (Kmt5c)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     232811 (Kmt5c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     232811 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 232811
NCBI-ProteinID: NP_001108490
MGI: 2385262
Ensembl: ENSMUSG00000059851
Vega: OTTMUSG00000017303
UniProt: Q6Q783
LinkDB All DBs
Structure
PDB: 

Position
7; 7 A1
AA seq 468 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPTLRRQHHLRSALEAFLRQRD
LEAAFRALTLGGWMAHYFQSRAPRQEAALKTHIFCYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREEDEDLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLQPREPELRPKPLDKYELRETKRRLQQGLVSSQQSLMSRWACSHLSPLRPDPFCAAC
QPSCLLPASPHMDYLPLWLQRAPQPQPIVPPRKRHRRRRPRIRQASLPPVLRTACVPLHR
WGGCGPHCQLRAEAMVTLHLRPQTRWTPQQDWYWARRYGLPSVGRVELTRLAPALPAAPA
PAGNPGPVPTPDFIPKQALAFAPFCPPKRLRLVVSHGSIDLDINSGEP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgatcgagtgacagcccgagaactgtgcgagaatgatgacctggccaccagc
cttgttcttgacccctacctcggcttccgcacccataagatgaatgtcagtcctgtgccc
accttgcgacgacaacaccaccttcgttcagcactggaagctttcctaaggcaacgggac
ctggaggctgcattccgggccctgacgctaggaggctggatggcccactacttccagagc
cgtgcccctcggcaggaggctgctctcaagacccacattttctgctacctccgcgccttc
ctgcctgagagtggcttcaccattctgccctgcacccgctactccatggagaccaatggg
gccaagattgtgtctacccgtgcttggaagaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgtgaagaggatgaagacctgcttagggccggtgagaacgacttc
agcatcatgtactccacccgaaaaaggagtgcccagctgtggcttggcccagctgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgccctcagatgggaatactgcctgt
gtgaaggtgctacgggacattgagccaggggatgaagtgacttgcttctatggtgagggc
ttcttcggcgagaagaatgagcactgtgaatgctatacctgtgagaggaaaggcgaggga
gctttcagacttcagcccagggagcctgagctgcgaccaaagcccctagacaagtatgag
ctccgagagacaaagaggcgtctgcagcagggcttggtcagcagccagcagagcctgatg
agccggtgggcctgctcccacctgtccccactgcgccctgacccattctgtgctgcctgc
cagccctcatgcctgctgcctgccagcccccacatggattacttgcccctttggctccag
cgggcgcctcaaccccagcccatagtacctcccaggaagcgccaccgccgccgccgcccc
aggatccgccaggcttcattgcctcctgtcctccgcactgcctgtgtccccctgcaccga
tggggaggctgtggtccccactgccagctacgtgctgaggccatggtgaccctacacctg
cgcccccagactcgctggaccccacaacaggactggtactgggcccggcgctatgggcta
ccttctgtggggcgtgtggaacttacccgcctagccccagccctgccagctgctcctgcc
cctgctgggaacccaggtcctgtccccactcctgatttcatccctaagcaggcccttgcc
tttgctccgttctgcccacctaagcgcctccggctagtggtcagtcatggttctattgat
ctggacatcaatagtggtgagccatga

DBGET integrated database retrieval system