KEGG   Mus musculus (mouse): 233064
Entry
233064            CDS       T01002                                 

Gene name
Wdr62, 2310038K02Rik, b2b1508Clo
Definition
(RefSeq) WD repeat domain 62
  KO
K21762  WD repeat-containing protein 62
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    233064 (Wdr62)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    233064 (Wdr62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 233064
NCBI-ProteinID: NP_666298
MGI: 1923696
Ensembl: ENSMUSG00000037020
Vega: OTTMUSG00000024362
UniProt: E9QK36
LinkDB
Position
7; 7 B1
AA seq 1523 aa
MAALAAGGYTRSDTIEKLSSVMAGVPARRNQSSPPPAPPLCLRRRTRLAAAPEDTVQNRV
TLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVVLNPKENKQQHIFNTTRKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKTQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEASTEAKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGNTFCVSYSGLLCQFNEKRVLDKWINLKVSLSSC
LCVSDELIFCGCTDGIVRIFQAHSLLYLTNLPKPHYLGVDVAHGLDSSFLFHRKAEAVYP
DTVALTFDPVHQWLSCVYKDHSIYIWDVKDIDEVSKIWSELFHSSFVWNVEVYPEFEDQR
ACLPSGTFLTCSSDNTIRFWNLDSASDTRWQKNIFSDSLLKVVYVENDIQHLQDLSHFPD
RGSENGTPMDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELIKVEAHDAEVLCL
EYSKPETGVTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGTRDVQMISCG
ADKSIYFRSAQQASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISLIDFYSGECVAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITTCMKQHLLEINHQEQQQQPKDQKWSGPPSQE
TYASTPSEIRSLSPGEQTEDEMEEECEPEELLKTPSKDSLDPDPRCLLTNGKLPLWAKRL
LGDDDVADSSAFHAKRSYQPHGRWAERAEQEPLKTILDAWSLDSYFTPMKPENLQDSVLD
SVEPQNLAGLLSECSLGNGHTSPGEGLVSYLLHPELGSPKEDNRGHPSYLPLQREATEAS
ELILCSPEAEVSLTGMHREYYEEETEAGPEDQQGDTYLRVSSVSSKDQSPPEDSGESEAE
LECSFAAAHSSAPQTDPGPHLTMTAGKPEYPSTEELSQPELPGLGNGSLPQTPEQEKFLR
HHFETLTDAPTEELFHGSLGDIKISETEDYFFNPRLSISTQFLSRLQKTSRCPPRLPLHL
MKSPEAQPVGQGGNQPKAGPLRAGTGYMSSDGTNVLSGQKAEETQEALSLLDRKPPTPTS
VLTTGREQSISAPSSCSYLESTTSSHAKTTRSISLGDSEGPVTAELPQSLHKPLSPGQEL
QAIPTTVALTSSIKDHEPAPLSWGNHEARASLKLTLSSVCEQLLSPPPQEPPITHVWSQE
PVDVPPSMAVTVASFCAPSPVDMSTLGLHSSMFLPKTSASGPLTPPAHLQLLETRSRVPG
STAALLEPTPDASGVIADSPGHWDTEVPTPELLGSVESVLHRLQTAFQEALDLYRMLVSS
SQLGPEQQQAQTELASTFHWILNQLEASNCMAAANLAPPQTLPSPDPLSLPTLCPLASPN
LQALLEHYSELLVQAVRRKARGD
NT seq 4572 nt   +upstreamnt  +downstreamnt
atggctgccttagcggccggaggttatacgcggagtgacacgatagaaaagctgtcctct
gtcatggcgggagttccggcgcggagaaaccagtcctccccgcctcctgccccaccgctc
tgcctccggcggcggacgcgactcgcggcggctcccgaggacactgtgcagaaccgggtg
acacttgagaaggtgcttggcatcacagcccagaacagcagcgggctaacctgtgaccct
ggcacaggccatgtggcctacttagcagggtgcgtggtggtggtcttgaaccccaaggag
aacaagcagcagcatatatttaacacaaccaggaagtccctgagtgctctggccttctcc
ccagatgggaagtacatagtgacaggagagaatggacaccggccagctgtgcgcatctgg
gatgtggaggagaagactcaagtggcagagatgctgggccacaagtatggtgtggcctgt
gtggctttctcacccaatatgaagcacatcgtgtccatgggctaccaacatgacatggtc
ctcaatgtttgggattggaagaaagacattgtggtggcttccaacaaggtgtcatgtaga
gtcatcgctctctccttctctgaggacagcagctattttgtcaccgttgggaatcggcat
gtgaggttttggttcttagaagcctctactgaggccaaggtaaccagcacagtgcccctg
gtaggacgctcaggcatcctgggtgagctgcacaacaatatcttttgtggcgtggcctgc
ggccggggccggatggcaggcaataccttctgtgtgtcctactctggcctcctctgccag
ttcaatgagaaaagggtgctggacaagtggatcaacctgaaggtctccttgtcttcctgc
ctgtgtgtcagtgacgagttgatcttctgtggatgcacagacgggatagtccgcatcttc
caggcccacagcctactctacctcaccaacctgcccaaaccacactacctgggagtggac
gtggcccacggactggactccagcttcctcttccacagaaaagcagaagcagtctaccca
gatacagtggccctgacctttgaccccgtccaccagtggctgtcctgtgtttacaaagac
cacagcatctacatctgggatgtcaaggacattgatgaagtcagcaagatatggtcagag
ctcttccacagctcctttgtctggaatgtagaggtgtaccctgaatttgaagaccagaga
gcttgcctgccgtccgggacttttctgacttgttcctcagacaataccatccgcttctgg
aatttggatagcgcctctgacactcgatggcaaaagaacatcttcagcgattctctgctg
aaggtggtctatgtagagaatgacatccagcacctgcaggacctgtctcacttcccagac
cggggcagtgagaacggcactcccatggatatgaaagctggggttcgagtcatgcaggtc
agtcctgacggccagcacttggcttcaggcgaccgcagtggaaatctgaggatccacgag
ctgcacttcatggatgagctgatcaaggtggaggcccacgatgctgaggtgctgtgcctg
gagtactccaagcctgagacaggagtgactttgctggcttcagccagtcgggacagactc
atccatgtgttaaacgtggagaagaactacaacctggagcagaccctggacgaccactcc
tcctccatcacagccattaagtttgctggcaccagagatgtccagatgatcagttgtgga
gctgacaagagcatctactttcgcagtgcccagcaggcctcggatggactgcactttgtc
cgtacccaccacgtagcagagaagaccaccttgtatgacatggatatcgacatcacacag
aagtatgtggcagtggcctgccaggaccgcaacgtaagggtctacaacaccgtgagtggg
aaacagaagaagtgctacaagggttcccagggcgacgaagggtccctgctgaaggtccac
gtggacccctcaggcaccttcctggccacaagctgctctgacaaaagcatctccttgatt
gacttttactcgggcgagtgtgttgccaagatgtttggccattcggaaattgtcactggc
atgaagttcacctacgactgccgccacttgatcacagtatctggagacagctgtgtgttc
atctggcacctgggcccggagatcaccacctgcatgaagcagcacttgctggagatcaac
caccaggagcagcagcagcagcccaaggaccagaagtggagtggccctcccagccaggag
acatatgcatccacaccaagtgagattcgttccctgagccctggagagcagacagaggat
gagatggaggaggaatgtgagccagaagagttgctgaaaacaccatccaaagacagcttg
gacccagatcctcgatgcctgctgacaaatggcaagctgccactctgggcaaagcggctg
ctaggggatgatgatgtggcagacagctcagctttccacgccaagcgcagctaccagcca
catggccgttgggcagagcgggctgagcaggaacccctcaagaccatcctggatgcctgg
agcctggattcctactttacacccatgaagcctgaaaatctccaagactctgttctggac
tcagtagagccacagaacctggcaggcctgctaagtgagtgttcactcggtaatggacac
acgtctccgggagaaggcttggtgagctacctacttcacccagagttagggagtcccaaa
gaggacaaccgaggccacccctcctacctgcctctacagagggaagccaccgaggcaagc
gaactcatcctctgctccccagaggcggaagtgtcacttacagggatgcacagggagtat
tatgaggaggagacagaggcaggacctgaagaccagcaaggcgacacctatctcagggtc
tcttccgtcagttcaaaggatcagagcccccctgaggactcaggggagtcagaggctgaa
ctggagtgcagctttgccgccgcccacagctcagctcctcaaacggaccctggccctcac
ctcaccatgacagcaggtaagccagagtacccaagtacagaagagctttcccagcctgag
ctgccaggcttgggcaatggctccttaccccagacacctgagcaggagaagttcctccgc
caccattttgagacacttactgatgcccctactgaagagctctttcatggatccctggga
gacataaagatctcagagactgaggactatttcttcaatccccggctgagcatatccacc
cagttcctctcccgcctccagaagacctccaggtgccctccccgactgcccctgcacctt
atgaagtctccagaggctcagcctgtgggccaagggggcaaccagcccaaagcagggccc
ctgagagcaggtactggctacatgtcctcagatgggaccaacgtcctctctgggcagaag
gctgaagaaactcaagaggccttgagtctactggacaggaagcctccaacacccacatct
gtactgaccacaggccgggagcaaagtatctccgccccatcttcgtgttcttacctggag
tccacaacgagctcacatgccaagacgacacgcagcatctctcttggggacagtgagggc
cctgtgacagctgagctaccccagtcacttcacaagcccttatcccctggccaggaactc
caagccatccccactacagtggcactgacctccagcatcaaagaccacgagcctgcaccg
ctttcctggggcaaccatgaggcccgagccagcctgaaactgaccttatccagtgtctgt
gagcagctgctctctccacctccacaggagccacccatcacccatgtgtggtctcaggaa
cctgtggatgtcccacctagtatggcagtcacagtagccagcttctgtgcacccagccct
gtagacatgagcaccctgggactccacagttctatgtttctcccaaagacctcagcctct
gggcccctaacccctcctgcccacctccaacttctagagaccaggtctagggtgcctggc
agcactgctgctctcctggagcccacccccgatgcatcaggtgtgatcgcagacagccct
ggacactgggacacagaagtccctaccccagaactcctaggcagtgtggaatcagtcttg
cacaggctgcagactgccttccaagaagctcttgacctttaccgcatgctggtctccagc
agccagctgggtcctgagcagcagcaggcacagaccgagctggcctccaccttccactgg
atcctcaaccagctagaagccagcaactgtatggctgcagctaacttggccccaccccag
acactgcctagcccagaccctctgtccctacctacactttgtcccctggccagcccaaac
ctgcaggccctgctggaacactactcagagttgctggtgcaagcagtgaggaggaaggca
aggggtgactga

DBGET integrated database retrieval system