KEGG   Mus musculus (mouse): 235587Help
Entry
235587            CDS       T01002                                 

Gene name
Parp3, A930002C11Rik, ADPRT-3, ARTD3, AW990611, Adprt3, Adprtl3, PARP-3, pADPRT-3
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    235587 (Parp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    235587 (Parp3)
   04217 Necroptosis
    235587 (Parp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    235587 (Parp3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    235587 (Parp3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    235587 (Parp3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     235587 (Parp3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     235587 (Parp3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    235587 (Parp3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     235587 (Parp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 235587
NCBI-ProteinID: NP_001298079
MGI: 1891258
Ensembl: ENSMUSG00000023249
Vega: OTTMUSG00000033581
UniProt: Q3ULW8
LinkDB All DBs
Position
9; 9 F1
AA seq 533 aa AA seqDB search
MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPADNRVIRVDPSCPFSRNPGIQV
HEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQSKMNHFTCLEDAKK
DFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKALSPQVYSGPVRTVVK
PCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMK
NPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTLQAA
PGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLRHVWK
VNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPA
QDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRYLLEIHL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaacgaaaggcctctgtgcagactgagggctccaagaagcggcgacaaggg
acagaggaggaggacagcttccggtccactgccgaggctctcagagcagcacctgctgat
aatcgggtcatccgtgtggacccctcatgtccattcagccggaaccccgggatacaggtc
cacgaggactatgactgtaccctgaaccagaccaacatcggcaacaacaacaacaagttc
tatattatccaactgctggaggagggtagtcgcttcttctgctggaatcgctggggccgc
gtgggagaggtgggccagagcaagatgaaccacttcacctgcctggaagatgcaaagaag
gactttaagaagaaattttgggagaagactaaaaacaaatgggaggagcgggaccgtttt
gtggcccagcccaacaagtacacacttatagaagtccagggagaagcagagagccaagag
gctgtagtgaaggccttatctccccaggtgtacagcggccctgtgaggaccgtggtcaag
ccctgctccctagaccctgccacccagaaccttatcaccaacatcttcagcaaagagatg
ttcaagaatgcaatgaccctcatgaacctggatgtgaagaagatgcccttgggaaagctg
accaagcagcagattgcccgtggcttcgaggccttggaagctctagaggaggccatgaaa
aaccccacaggggatggccagagcctggaagagctctcctcctgcttctacactgtcatc
ccacacaacttcggccgcagccgacccccgcccatcaactcccctgatgtgcttcaggcc
aagaaggacatgctgctggtgctagcggacatcgagttggcgcagaccttgcaggcagcc
cctggggaggaggaggagaaagtggaagaggtgccacacccactggatcgagactaccag
ctcctcaggtgccagcttcaactgctggactccggggagtccgagtacaaggcaatacag
acctacctgaaacagactggcaacagctacaggtgcccagacctgcggcatgtttggaaa
gtgaaccgagaaggggagggagacaggttccaggcccactccaaactgggcaatcggagg
ctgctgtggcacggcaccaatgtggccgtggtggctgccatcctcaccagtgggctccga
atcatgccacactcgggtggtcgtgttggcaagggtatttattttgcctctgagaacagc
aagtcagctggctatgttaccaccatgcactgtgggggccaccaggtgggctacatgttc
ctgggcgaggtggccctcggcaaagagcaccacatcaccatcgatgaccccagcttgaag
agtccaccctctggctttgacagcgtcatcgcccgaggccaaacggagccggatcccgcc
caggacattgaactcgaactggatgggcagccggtggtggtgccccaaggcccgcctgtg
cagtgcccgtcattcaaaagctccagcttcagccagagtgaatacctcatatacaaggag
agccagtgtcgcctgcgctacctgctggagattcacctctaa

DBGET integrated database retrieval system