KEGG   Mus musculus (mouse): 235626Help
Entry
235626            CDS       T01002                                 

Gene name
Setd2, 4921524K10Rik, BC031601, KMT3A
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    235626 (Setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    235626 (Setd2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     235626 (Setd2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     235626 (Setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 235626
NCBI-ProteinID: NP_001074809
MGI: 1918177
Ensembl: ENSMUSG00000044791
Vega: OTTMUSG00000033479
UniProt: E9Q5F9
LinkDB All DBs
Position
9; 9 F2
AA seq 2537 aa AA seqDB search
MKPLPSQQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPVFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSFTKKTLQNRFLTALSNEKQSDSPNSPAPPLQVDSNPKVKMD
AGDTFPATEESSPPKSRVELGRIHFKKHLLHVTSRPQLAASTTAASPLPPTTQLPAVLAE
SMIDSPPSSPPPPPPPPQASSPSPPAQISEPVALPQPPATALMTSPPGPLPGDVAVRAQK
ESPVKSGPEVLEVDTKQDIVSNSLEEHTVQTLKEQADHLLQKEDSHIGKEEEVSDGSKIS
LSSKKASSKKKSSQFEGTFLGSESDEDSVRTSSSQRSHDLKSSTSIDKERDFKKSSAPSK
SEDLGKSSRSKTERDDRYCSYSKLERDTRYVSSRCRSERDRRRSRSRSRSDRASRTSLSY
SRSERSHYYDSERRYHRSSPYRERTRYSRPYTDNRARESSDSEDEYKKTYPRRTSAHSYR
DLRTSSSYSKFDRDCKTETSYLEMERRGKYTSKLERESKRTSEHETIKRCCSPPNELGFR
RGSSYSKHDNSTSRYKSALSKSISKNDKFKNSFCCTELNEENKQSHSFSLQTPCSKGSEL
RTINKISEREKTGSPTPSNQLNDSPTFKKLDESPVLKPEFIGHDGRESIKELELSKVKND
QLRNFCSIELNVNGSPETEADVATFCTSKTDAISMTSDDSVTGSEVSPLIKACMLSSNGF
QNVGRCRERDSDDTCRQHNTSKSPFREMEPLLSPHHDKLMSLPVKTIDYPKTLIKEPVDK
RHSCCKTKDSDIYCSPNENPEAENAEPSAMTISSHSFVNVHLESKTVICDNREPTDRHSE
NTCDEYKQSIGSTSSASHNHFDGLYEPIGSSGISSLQSPPSGIRCEENTSPTLDAVESKK
GIDFLKYARKETDVGSALPDSGKGFSWENRHNNVLSGQSLQEAQEEGNSILHERRGRPEI
PLDEEQRGHTHISDDSEVVFPYDLNLTMEDSDGITYTLKCDSSGNAPEIVSTVHEDYSGS
SASSSDESDSEDTESDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYKHYSDRW
EDGLETRRHAYEEEYESKGCSQTEKYFLHKGTERSAESCYSQFGRKADNHLPDIAHAQSD
GVDSTSQTDSRSDHLGHLNPEDTLRAKTSRPQELPVYSDDFEDLPNKSRQQMIFSNRPDS
SRLGKTELSFSSSCDISRMDGLHSSEELRNLGWDFSQQERPTTTYQQPDSSYGTCGTHKY
QQSTEHYGGTHNYWQGNGYWDPRSAGRPPGTGLAYDRIQGQVPDSLTDDREEEEHWDQRS
GSHFSSPSNKFFFHQKDKGSVQAPEISSNSIKDALVMNERKDFSKNFEKNDIKERGPPKK
RRQELESDSESDGELQARKKVRVEMEQGESSVPQHSELMGPSCAMDDFRDPQRWKEFAKL
GKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEVACGEDCLNRLLM
IECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDH
KEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQL
RVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKK
ERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSC
LKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQR
WSQTKTAVPQLSEGDGYSSENTSRAHTPLNTPDPSAKPSTEMDTDTPKKLIFRRLKIISE
NSMDSAVSDVTSELECKDGKEDLDQLETVTVEEDEELQSQQLLPQQLCESKVESEATIEV
SKLPTSEPEADTETEPKDSNGTKLEETIAEETPSQDEEEGVSDVESERSQEPPDKTVDIS
DLATKLLDSWKDLKEVYRIPKKSQTEKESTVAERGRDAAAFRDQTAPKTPNRSRERDPDK
QSQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQ
EVAQREAQKQQQQMQNLGMTSPLPFDSLGYNASHHPFAGYPPGYPMQAYVDPSNPNAGKV
LLPTPSMDPVCSPAPYDHAQPLVGHSTESLAAPPSVPVVPHVAASVEVSSSQYVAQNESV
VHQDSNVPVMPVQAPGPVQGQNYNVWESNQQSVSVQQQYSPAQSQTTIYYQGQTCSTVYS
VTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPTAAVTSIVAPGQPQSLQPP
EMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGD
DASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLN
PYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKY
MQKFGAVYKPKEDTELE
NT seq 7614 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgctgccgtcgcagcagccgccaccgaagatgggggatttctacgatcccgag
cacccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggt
ttcatcaaaggaccagtgttcaaaggtgttgcttcaagtcgatttttgcccaaaggcacg
aagacaaaagttaatttggaggaacagggacggcaaaaggtgtcattcagcttcagtttt
acaaagaaaactttacagaatagatttctcactgcgcttagcaatgaaaagcaaagtgat
tctccaaactccccagctccccctcttcaagtagactcaaaccctaaagttaaaatggac
gctggagatacttttcctgctacagaagaatcttcgccaccaaaatcgagagtggaattg
ggcagaattcattttaagaaacatttgcttcatgtgacatctaggccacagctggctgca
agtacaacagcagcatctccccttcctcctacaacacagttaccagcagtcttagcagag
tcgatgatagactcaccaccttcatctccacccccacctcctccacctccccaggcctca
tcaccctcaccaccagcacagatatcagagccagtggccttgccgcaacccccagcaaca
gcactaatgacatcaccaccaggacctttaccaggagacgtagccgtgagagctcagaaa
gaatcaccagttaaaagtggacccgaagttttagaggtggatacaaagcaagatattgta
tctaatagtttggaagaacacacagttcaaactttgaaggaacaagcagatcatctcctg
caaaaagaagattcccatattgggaaggaagaagaggtttcagatggctctaagataagc
ctcagttctaaaaaagcaagttctaagaagaaatcttcacaatttgaaggcacatttctt
ggttcagagtctgatgaagattctgtacggacttcttccagtcaaagatcacatgattta
aaatcttcaacaagcattgacaaggaaagagattttaagaagagctcagcaccttcaaaa
agtgaggatttggggaaatcatcaagatcgaaaacagagagagatgatagatattgtagc
tactcaaaacttgaacgagatactcggtatgtatcttcccgatgtcggtccgaaagagat
cgaaggcgaagccgatctcgttctagatctgacagagcctctagaactagtttgtcttat
tctcgctcagaaagatctcattattatgattctgaacggcgctaccataggagttcccct
tatcgtgagaggacacgctattctcggccatatactgataacagggcacgggagagctca
gactctgaagatgagtataagaagacatacccacggcgtacctcagcccattcctacaga
gacctaaggacatcatcatcttactctaaatttgatcgggactgtaaaactgagacctct
tacttagagatggagagaagaggaaagtatacttcaaaactagaaagagaatccaaacgg
acttcagagcatgaaaccataaaaagatgttgttctcccccaaatgaactgggattccga
cgggggtcatcatattccaagcatgataacagtacttcccgttataaatctgccctttca
aaatctatatccaagaatgataaatttaaaaattctttctgttgtacagaattaaatgag
gaaaacaaacaatctcattcgtttagtttgcagactccttgttcaaaaggtagtgaatta
agaacaattaataagatttctgaaagagaaaagactgggtctccaactccatcaaatcaa
ttaaacgattcacctacttttaaaaagctagatgaatctcctgttcttaagcctgaattt
ataggacacgatggccgtgaaagtattaaagaattggagttatcaaaagtgaaaaatgat
caattaagaaatttttgttccattgaattaaatgtaaacggatctccagagacagaagct
gatgtggcaacattttgtacttctaagacagatgctatatcaatgacttctgatgatagt
gtgactggatcagaggtatcccctttgatcaaggcttgcatgctttcatcaaatggattt
cagaatgttggtagatgcagagaaagggactcagatgatacttgtaggcagcataatacg
tcaaaaagtccatttagggaaatggaacctttgttgtcaccacaccatgataaactcatg
tctttgccagttaagactatagattatcccaaaacattaattaaagaaccagttgataag
agacattcttgctgcaaaaccaaagattcagatatatactgttctccaaatgaaaaccct
gaagctgagaacgctgaaccttcagctatgacgatttcttcacatagctttgtgaatgtg
catttggaatccaagacagttatatgtgataatagggagccgacagaccggcactcagag
aatacatgtgatgaatataagcagagcattggtagcactagttcagcttctcataaccat
tttgatggtttgtatgagcctatagggagttcaggtatttcatctctccagagtcctccg
tcaggaataagatgtgaagaaaacacatctccaactctagatgcagtggagagtaaaaaa
ggcatagattttttaaagtatgcacggaaagaaacagatgttggtagtgcccttcctgat
tcaggaaaaggattttcttgggaaaacaggcataataatgtgttatctgggcagtctttg
caagaggctcaagaagaagggaattccatattgcatgagagaagaggaagaccagaaatc
cccttagatgaggaacaaagaggccatacacatatttctgatgattcagaagtggtattt
ccttatgatttgaacttgaccatggaagacagtgatggtataacctacaccttaaaatgt
gatagtagtggaaatgctccagagattgtatctactgtccatgaagactattctggatct
tctgcaagttcaagcgatgaaagtgattctgaagatacagagtctgatgatagcagtatt
ccaagaaaccgactccagtctgttgtggttgtgccaaagaattctactttgcccatggaa
gagacaagtccctgttcttctcggagcagtcagagctacaaacattattctgaccgctgg
gaagatggattagagaccaggagacatgcatatgaggaagagtatgagagtaaaggctgt
tctcaaactgaaaaatacttccttcataaaggaacagagagaagtgcagaaagttgttat
tcacagtttggcaggaaagcagataatcacctgcctgacattgctcatgctcagagtgac
ggggttgatagtacaagtcagacagactcgagatctgaccatctaggtcacctgaatcca
gaggacacattaagagccaaaacatctaggccacaagagctaccagtttattctgacgat
tttgaagatctcccaaataagtctcggcagcagatgattttctctaatcggccagatagt
agtagactaggaaaaacagagctgagtttttcttcctcttgtgacatttcccgaatggat
ggcttgcactcatcagaagagctcagaaacctagggtgggacttttcccaacaggaaagg
cccaccaccacataccagcagcctgacagcagctatggaacctgtggtacacataagtat
caacaaagtactgaacactatggtgggacccataattactggcaaggcaatggctattgg
gatccaagatcagcaggtagacctccaggaactgggcttgcttatgatcgaatccaaggg
caagtaccagattctctaacagacgatcgtgaagaagaggaacattgggatcaacgaagt
ggatcacatttttcaagcccgtccaataaatttttcttccatcagaaggacaagggatca
gtgcaagcaccggaaataagcagcaattcaattaaagacgctttagttatgaacgaaagg
aaagatttttcgaaaaactttgaaaaaaatgatataaaagagagagggcctcctaaaaaa
cgaaggcaagagttggagagtgattctgaaagtgatggtgaactacaggctagaaagaaa
gttagagtggagatggagcagggagaatcatctgtgccccagcactcagaactgatgggg
ccttcgtgtgctatggatgacttcagggacccacagcggtggaaagaatttgccaagctg
gggaagatgccatgttactttgatcttattgaagaaaatgtttatttaacagaaaggaag
aagaacaaatcccaccgggatattaagcgaatgcagtgtgagtgtacacctctttctaag
gatgaaagagctcaaggtgaagtagcatgtggagaagattgccttaatcgtctcctcatg
attgaatgttcctctcgatgtccaaatggagattactgttcaaacagacggtttcagaga
aaacagcatgcagatgtagaagtcatacttacagaaaagaaaggctggggcttaagggct
gctaaggatcttccttcgaacacctttgtcctggaatactgtggagaggtacttgatcat
aaagagtttaaagctcgggtgaaagaatatgcacggaacaaaaacatccactactacttc
atggccctgaaaaatgacgagataatagatgccactcaaaaagggaattgctctcgtttc
atgaatcatagctgtgaaccaaactgtgaaacccagaaatggactgtgaatggacagctg
agggttggattttttaccaccaaactagttccttcaggctcagaattaacttttgactac
cagttccaaagatatggcaaagaagctcagaagtgtttctgtgggtcagccaactgccgg
ggctacttgggaggagaaaacagagtcagtatcagagctgcaggagggaagatgaaaaag
gaacgctctcgaaagaaggattcagtggatggagaacttgaagcactgatggaaaatggt
gaaggcctctctgataagaaccaggttcttagtttatcccggctcatggttagaattgaa
actttggaacagaaacttacctgtcttaagctcattcagaacacacactcacagtcctgc
ctcaagtcatttctggaacgtcatgggttgtcactgttgtggatctggatggcagagctt
ggcgacggccgggaaagtaaccagaagcttcaggaagagattataaagactttggagcat
ttgcccattcctactaaaaatatgttggaagaaagcaaagtacttccaattattcagcgc
tggtctcaaactaagactgctgttcctcagttaagtgaaggagacgggtattctagtgag
aatacatcacgtgctcacacaccgcttaatacaccggacccttctgccaagccgagcacg
gaaatggatacagatactcccaagaaactcatattccgcagactgaagattataagtgaa
aatagcatggacagtgcagtctcggacgtcactagtgagctagaatgcaaggatggcaaa
gaggaccttgatcagttagagactgtcactgtggaagaggatgaagagctgcagtcccag
cagctcctcccacagcagctgtgcgagtccaaagttgagagtgaagccactattgaagtc
agtaagttacccacatctgaaccggaggcagacacggagacagagcccaaagacagcaat
ggcacaaaactagaagaaactattgctgaggaaacaccatcccaagatgaagaagaggga
gtgtctgatgttgaaagtgagagaagccaggagccaccagataaaacagtggatataagt
gatttggctaccaagttactagacagttggaaagatctaaaggaggtgtatcggattcca
aagaaaagtcaaactgaaaaggagagcacagtagctgaacgaggaagagatgctgctgcc
ttcagagatcaaacagctccaaagactcctaacaggtctagagagagagacccagacaag
cagtctcaaaataaagagaaaaggaaacgacggggctctctgtcaccaccctcttctgca
tatgagcggggaacaaaaaggccagatgacagatatgatacaccaacttctaaaaagaaa
gtacgaattaaagaccgaaacaaactttctacagaggagcgcaggaagttgtttgaacaa
gaggtggcacagagggaagctcagaagcaacagcaacagatgcagaacttggggatgaca
tcaccactcccctttgactctctgggatataatgcctctcatcacccctttgctgggtac
ccaccaggttaccccatgcaagcctatgtggatcccagcaaccctaatgctggaaaggtg
cttctgcccacacctagcatggaccctgtgtgctcccctgctccttatgatcacgctcag
cccttggtaggacattctacagaatcccttgctgctcccccatctgtgccagtggtgccg
catgtggcagcctctgtggaagtttccagttctcagtatgtagctcagaatgaaagtgtt
gtacaccaagactccaatgttcctgtaatgccagtacaagctccaggcccagtccaagga
cagaattacaatgtctgggagtcaaaccaacagtctgtcagtgtacaacagcagtattct
cctgcacaatctcaaacaaccatatattatcaaggacagacatgttcaactgtctatagt
gtgacctcgccttattcacagacaactcctccaattgtgcagagttatgcccagccaagt
cttcagtatatccagggacagcagattttcacagctcacccacaaggagtggtggtacag
ccaactgcagccgtgacttcaatagttgcaccagggcagcctcagtccttacagccacct
gaaatggttgtaacaaataatctactggacctgccaccaccctcccctccaaaaccaaaa
acgattgttttacctcccaactggaagacagcccgagaccctgaggggaagatctactac
taccacgtgatcacaagacagactcagtgggatcctcctacttgggaaagcccaggagat
gatgccagccttgagcatgaagctgaaatggacctgggaaccccaacctatgatgaaaac
cccatgaagacatcaaaaaagcccaagacagcagaagcagacacctccagtgagctggca
aagaaaagcaaagaagtattcagaaaagagatgtctcagttcattgtccagtgcctgaat
ccttaccggaaacctgactgcaaggtgggcaggatcaccaccactgaagatttcaagcac
ctcgcccgaaagctgactcatggagttatgaataaggagctgaagtactgtaagaacccc
gaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtacatcaagaagtac
atgcagaagtttggggctgtttacaaacctaaagaggacactgaactagagtga

DBGET integrated database retrieval system