KEGG   Mus musculus (mouse): 23871Help
Entry
23871             CDS       T01002                                 

Gene name
Ets1, AI196000, AI448617, D230050P06, Ets-1, Tpl1, vs
Definition
(RefSeq) E26 avian leukemia oncogene 1, 5' domain
  KO
K02678  C-ets-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04218  Cellular senescence
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    23871 (Ets1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    23871 (Ets1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23871 (Ets1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    23871 (Ets1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    23871 (Ets1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    23871 (Ets1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    23871 (Ets1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Motif
Other DBs
NCBI-GeneID: 23871
NCBI-ProteinID: NP_035938
MGI: 95455
Ensembl: ENSMUSG00000032035
Vega: OTTMUSG00000044662
UniProt: P27577 Q540Q5 Q8BVW8
LinkDB All DBs
Structure
PDB: 

Position
9 A4; 9 17.97 cM
AA seq 440 aa AA seqDB search
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGR
ASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDAD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacagaaaaagtggat
ctcgagcttttcccttccccggacatggaatgtgcagatgtcccgctgttaactccgagc
agcaaagaaatgatgtcccaagccttgaaagctactttcagtggtttcacaaaagaacag
cagcgactgggaatccccaaagacccccggcagtggacagaaacccacgtccgggactgg
gtgatgtgggctgtgaatgagttcagcctgaaaggtgtggacttccagaagttctgtatg
agtggagcagcactgtgtgccctgggtaaagaatgcttcctcgagctggctccagacttt
gttggggatatcctgtgggagcatctagagatcctgcagaaagaggatgtgaaaccatat
caggttaatggagccaaccctacctacccagaatcctgttacacctcggattacttcatc
agctacggtatcgagcatgctcagtgtgttcctccctcagagttctcagagcccagcttc
atcacagagtcctatcagacgctgcatcctatcagctcggaagaactcctgtccctcaag
tatgagaacgactacccttctgtcattctccaggaccctctccagacagacaccttgcag
acagactactttgccatcaagcaagaggtgttaactccagacaacatgtgcctggggaga
gccagtcgtggtaaactcgggggccaggactcttttgagagcgtagagagctacgatagt
tgtgaccgcctcacccagtcctggagcagccagtcatccttcaacagcctgcagcgggtc
ccctcctatgacagcttcgactacgaggattatcccgctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgtgaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctggctggctacacaggaagtgggccgatccagctgtggcagttt
cttctggaattactcactgataagtcttgtcagtcctttatcagctggacaggagatggc
tgggaattcaagctttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggccttcgctactattatgacaaaaat
atcatccacaagacggcgggcaagcgctacgtataccgctttgtgtgcgacctgcagagc
ctgctgggatacacccctgaagagctgcacgccatgctggatgtaaagccggatgctgac
tag

DBGET integrated database retrieval system