KEGG   Mus musculus (mouse): 239017Help
Entry
239017            CDS       T01002                                 

Gene name
Ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    239017 (Ogdhl)
  09105 Amino acid metabolism
   00310 Lysine degradation
    239017 (Ogdhl)
   00380 Tryptophan metabolism
    239017 (Ogdhl)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     239017 (Ogdhl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 239017
NCBI-ProteinID: NP_001074599
MGI: 3616088
Ensembl: ENSMUSG00000021913
UniProt: B2RXT3 E9Q7L0
LinkDB All DBs
Position
14; 14 B
AA seq 1010 aa AA seqDB search
MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWL
ENPQSVHKSWDSFFQRASKEASVGPAQPQLPAVLQESRTSVSSCTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFRLPTTTF
IGGPENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSVEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGRKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPTTGIPEEM
LTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKKRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPL
IVFTPKSLLRHPDAKSSFDQMVSGTSFQRLIPEDGPAAHSPEQVQRLIFCTGKVYYDLVK
ERSSQGLEQQVAITRLEQISPFPFDLIMREAEKYSGAELVWCQEEHKNMGYYDYISPRFM
TLLGHSRPIWYVGRDPAAAPATGNKNAHLVSLRRFLDTAFNLKAFEGKTF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctgaggctgctgccattccggctggggccacgggccaccaagctcctggcc
acacgggctatcccggtgttcagtgggtgcaggaggtcttctggaccaccaacgaccatc
ccgaggagcagaagcggagtcagctccagttatgtggaagagatgtactttgcctggttg
gaaaacccacagagcgttcacaagtcctgggacagcttttttcagagagcaagtaaggag
gcctctgtgggtcctgctcagccgcagctcccagctgttctccaagaaagcaggacatca
gtgtcaagctgcaccaagaccagcaagctggtggaagaccacttggcagtccagtccctg
atccgggcctaccagatccgaggccaccatgtggcccagctggaccccctgggcatcctg
gatgcagacctagattcctttgtgccctctgacttgatcacaaccattgataaattggcc
ttctatgacctgcaggaggctgatctggataaggagttccggctgcccaccacgactttc
atcgggggcccagagaacacactctctcttcgagagatcatacgtcgcttggagagcacc
tactgccagcatattggcctggagttcatgtttattaatgacgtggaacagtgccagtgg
atcagacagaaatttgaaactcctggcgtgatgcagttttccgtcgaggagaagaggacc
ctgctggctagactggtgcgctccatgaggtttgaagacttcctggccaggaagtggtct
tcggagaagcggtttggcctggaaggctgcgaggtcatgattcctgctctcaagaccatt
atcgacaagtctagtgagatggggattgagaacgtcatcctggggatgccacacaggggc
aggctgaatgtgctggctaacgtgatccgcaaggacctggaacagatcttctgtcagttt
gatcccaagctggaagcagcagatgagggctctggtgatgtcaaataccatctgggcatg
taccacgagaggatcaaccgtgtcaccaacaggaacatcacattgtcactggtagccaac
ccttcccatctagaagctgtggaccccgtggtacagggcaagacgaaggcagagcagttc
taccgtggggatgcccagggtaggaaggtcatgtctatcctggtccatggggatgccgcc
ttcgctggccagggggtcgtctatgagaccttccatctcagtgacctgccttcttatacc
accaatggcacagtgcacgttgtggtcaacaaccagatcggcttcaccacagatccccga
atggctcgctcctccccttaccccactgatgtggcgcgggtggtcaatgcacccatcttc
catgtgaacgcagacgacccagaggctgtgatctatgtgtgcagtgtggcagctgagtgg
aggaacaccttcaacaaagatgttgttgtagacctggtctgttaccgccggcgtggtcac
aatgagatggacgagcccatgttcacgcagccactcatgtacaagcagatccacaagcag
gtacccgtgctgaagaagtatgcagacaagctcatcgccgagggcaccgtcactctgcag
gagtttgaggaggaaattgccaaatatgaccgtatctgtgaggaggcctacggcaggtcc
aaggataagaagatcctgcatataaagcactggctggactccccctggcctggcttcttc
aatgtggatggggagcccaagagcatgacatgccctacgacaggcatccctgaggagatg
ctgacccacattggcagtgtggccagctctgtgcccctggaggactttaagatccacaca
ggcctctctcgcatcctgcgtggccgtgcagacatgacaaagaagcgcacagtggactgg
gccctggcagagtacatggcctttggttcattgctgaaggagggcatccacgtgcgactc
agcggccaggatgtggagaggggcacattcagccaccggcaccatgttcttcatgaccag
gaagttgaccggaggacgtgtgtcccgatgaatcatctgtggcctgaccaggccccgtac
actgtgtgcaatagctccctctcagagtatggagttctaggctttgagctgggctatgcc
atggccagccccaacgccctggtcctctgggaagctcagtttggtgatttccacaacaca
gcccagtgtatcatcgaccagttcatcagcactggccaggccaagtgggtgcggcacaat
ggcatcgtgcttctgctgccccacggcatggagggcatgggtccagagcactcctcagca
aggccagagaggttcctgcagatgagcaatgacgactcggatgcctacccagtgttcact
gaggactttgaggtgagccagctctacgactgcaactggattgtggtgaactgctccacc
ccagccagctacttccacgtgctgcgccgacagatcctgctgcccttccgcaagcctctc
attgtcttcacacccaagtctctgctgaggcaccctgatgccaagtccagctttgaccag
atggtgtccggaactagcttccagcggctgattccggaagacggccccgcagcacattct
cctgagcaggtccagcggctcatcttctgcacgggaaaggtgtactatgacctggtaaag
gaacgcagcagccagggcctggagcaacaagtggccatcacacgcctggagcagatctct
ccgtttcctttcgacctgatcatgcgggaggcagagaagtactcgggagctgagctggtg
tggtgtcaggaggaacataagaacatgggctattacgactacatcagtccacgcttcatg
actctcctcggccactcccggcccatatggtatgtcggccgggacccagcagccgcacca
gccactgggaataagaacgctcacttggtgtcactgaggaggtttctggatactgccttc
aatctgaaggccttcgagggcaagacattttag

DBGET integrated database retrieval system