KEGG   Mus musculus (mouse): 239556Help
Entry
239556            CDS       T01002                                 

Gene name
Cacna1i, Ca(V)3.3
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 1I subunit
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04713  Circadian entrainment
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    239556 (Cacna1i)
   04020 Calcium signaling pathway
    239556 (Cacna1i)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    239556 (Cacna1i)
   04925 Aldosterone synthesis and secretion
    239556 (Cacna1i)
   04927 Cortisol synthesis and secretion
    239556 (Cacna1i)
  09159 Environmental adaptation
   04713 Circadian entrainment
    239556 (Cacna1i)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    239556 (Cacna1i)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    239556 (Cacna1i)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   239556 (Cacna1i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 239556
NCBI-ProteinID: NP_001037773
MGI: 2178051
Ensembl: ENSMUSG00000022416
Vega: OTTMUSG00000034511
UniProt: E9Q7P2
LinkDB All DBs
Position
15; 15 E1
AA seq 2199 aa AA seqDB search
MADSNLPPSSSAAPDPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDVPHPDLAPVAFFCL
RQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFI
FIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRV
LRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLE
ENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDMYD
FGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEI
MYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSS
STVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQATGPGTPAPAKPGPHAK
EPSHCKLCPRHSPLDTTPHTLVQPISAILASDPSSCPRCQHEAGRRPSGLGSTDSGQEGS
GSGGSAEAEANGDGPQSSEDGVSSGLGKEEEQEDGAARLCGDVWRETRAKLRGIVDSKYF
NRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRN
PYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNV
ATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQED
WNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSS
SNLEELDKLPEGLDSSRDLKLCPIPMTPNGHLDPSLPLGGHLGPAGAMGAAPRLSLQPDP
VLVALESRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGTWASRRSSWNSLKHKPPSAE
HESLLSGERGGSCVRACEGAREDAPPRAAPLHAPHTHHAHHGPHLAHRHRHHRRTLSLDT
RDSVDLAELVPVVGAHSRAAWRAAGQAPGHEDCNGRMPNIAKDVFTKMDDRRDRGEDEEE
IDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKFRILCQTIIAHKLFDYVVLAFIF
LNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWN
VLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLIS
SLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKY
NFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFF
VLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIH
SMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAF
GLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKM
ATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATF
ENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVL
INVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLGPGPGPCPCPCPCPCPCPCPGPR
MPTSSPGAPGRGSGGAGVGGDTESHLCRHCYSPAQETLWLDSVSLIIKDSLEGELTIIDN
LSGSIFHHYSSPAGCDKCHHDKQEVQLAETEAFSLNSDRSSSVLLGDDLSLEDPTACPQG
PKESKGELEPPEPMQAGDLDECFFPFAGEPVSAGPESLLCEMGAIPFNPVQSWLKHESNQ
APPSPFSPDGSSPLLQMPAEFFHPAVSASQKGQEPGMSSGTLPKIALQGSWASLRSPSVN
CTLLRQATVSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRRALGPPVQVPGPRASLSPAT
RRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTYHDSMDPSDEEGRGGAGGGGAGSEH
SETLSSLSLTSLFCLPPTLPPPGLTPARKFSSTSSLAAGPGRPGATVSVRGLARSPSWAA
DRSKDPPGQAQLASGFGSSAPEPQPPPGESTDAASKRKR
NT seq 6600 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagcaacttaccaccctcatcttcagcagccccggaccctgagccgggaatc
actgagcagccggggccccggagtccccctccatcccctccaggcctggaggagccattg
gatggaaccaaccctgacgtcccgcatccagacctggcacccgttgccttcttctgcctg
cgccagaccacgagcccacggaactggtgcatcaagatggtatgtaacccgtggttcgag
tgtgtgagcatgctggtcatcctgctgaactgtgtgaccctgggcatgtaccagccatgt
gacgatatggagtgcctctcagaccgctgcaagatcctgcaggtctttgatgacttcatc
ttcatcttcttcgccatggagatggtgcttaagatggtggccctgggcatttttggcaag
aagtgctacctcggggacacatggaaccgcttggacttcttcattgtcatggcagggatg
gtcgagtactctctggacctacagaacatcaacctgtcagccatccgcactgtgcgtgtc
ctgaggcctctcaaagccatcaaccgtgttcccagcatgcggattctggtgaacctgctg
ctggacacgctgcccatgctgggaaacgtgctcctgctctgtttcttcgtcttcttcatc
tttggcatcatcggcgtgcagctctgggcaggcctgctgcggaaccgctgcttcctggag
gagaacttcaccatacaaggggatgtggccctgcccccttactaccaaccagaagaggac
gacgagatgcccttcatctgctccctgtcgggggacaatggcattatgggctgtcacgag
atccctccactcaaggagcagggccgagagtgctgcctgtccaaagatgacatgtacgac
ttcggggcgggacgccaagacctcaacgccagcggcctctgcgtcaactggaaccgctac
tacaacgtctgccgcacgggcaacgccaaccctcacaagggcgccatcaactttgacaac
attggctatgcctggatcgtgatctttcaggtgatcactctggaaggctgggtggagatc
atgtactacgtgatggatgcacattctttctacaacttcatctacttcatcctgctcatc
atagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttctct
gagaccaagcaacgggagcaccggctgatgctggagcaacgccagcgctacctgtcctcc
agcacggtggccagttacgccgagcccggcgactgctatgaggagatcttccaatatgtc
tgtcacatccttcgcaaggccaagcgccgtgctctaggcctctaccaggccctgcagaac
cggcgccaggccacgggccccgggacaccagcccctgccaagcctgggccccatgccaag
gagcccagccactgcaagctgtgcccacgacacagtcccctggacaccactccccacaca
ctggtgcagcccatctctgccattctggcctccgatcccagcagctgccctcgctgccag
cacgaggcaggcaggcggccctctggcctgggcagcactgactcgggccaggaaggctca
ggttctggcggttctgcagaggctgaagccaatggcgatggaccccaaagcagtgaggat
ggggtctcctcaggtttggggaaggaggaggaacaggaggacggggcagcccgactgtgt
ggggatgtgtggcgagagacacgggccaagctgcggggcattgtggacagcaagtacttc
aacagaggcatcatgatggctattctggttaacactgtcagcatgggcatcgagcaccat
gaacagccagaggaactgaccaacatcctggagatctgcaacgtggtcttcaccagcatg
tttgccctggagatgattctgaagctggctgcctttgggctctttgactacctgcggaac
ccttacaacatcttcgacagcatcattgtcatcatcagcatctgggaaatcgtggggcag
gctgacggcggcctgtccgtgctgcgcaccttccggctgctgcgggtgctgaagctggtg
cgcttcatgccggcgctgcggcgccagctcgtggtgctcatgaagaccatggacaacgtg
gccaccttctgcatgctgctcatgctcttcattttcatcttcagcatccttgggatgcat
atctttggctgcaaattcagcctccgcacggacactggagacacagtccctgacaggaag
aacttcgattccttactgtgggccatcgtcaccgtgtttcagatcctcactcaggaggac
tggaacgttgtcctgtacaatggcatggcctccaccaccccctgggcctccctctatttt
gttgccctcatgacctttggcaactatgttctcttcaatctcctggtggctatcctggtc
gagggcttccaggctgagggtgatgctaatcgctcctactcagacgaggaccagagctca
tccaacttggaggagcttgataagctcccagagggcctggacagcagcagagatctcaag
ctctgcccaatacccatgacacccaatggacacctggaccctagtctccctctgggtgga
catctgggtcctgctggtgccatgggtgctgccccccgcctctcactgcagccagaccca
gtgctggtggccctagaatcccggaaaagcagtgtcatgtcactgggcaggatgagctat
gatcagcgatctttgtccagctcccggagctcctactatgggccctggggccgcagcggg
acctgggccagccgccgctccagctggaacagcctgaaacacaagccaccctcagctgag
cacgagtccctgctctccggggagcgtggtggtagttgcgtcagggcctgtgaaggcgcc
cgggaggatgcgccacctcgcgctgcacccctgcatgccccgcacacccaccacgcgcat
catggaccccacttggcacaccgtcaccgccaccaccgtcggacactgtcccttgatacc
agggactctgttgacctggcagagctggtgcccgtggtgggtgcccactcgcgggccgct
tggagggcggcaggccaggcccctgggcacgaggactgcaatggcagaatgcccaacata
gccaaggatgtcttcaccaagatggacgaccgccgcgaccgtggggaggacgaggaggag
atcgactacaccctgtgtttccgcgtccgcaagatgattgatgtgtacaagcctgactgg
tgcgaagtccgcgaggactggtcggtctacctcttctcccctgagaacaagttccggatc
ctgtgtcagaccattattgctcacaagctttttgactacgtggtcttggccttcatcttc
ctcaactgtatcaccattgctctggagaggccccagatcgaagctggtagcactgagcgc
atcttcctcacggtgtctaactacatcttcacagccatctttgtgggcgagatgacactg
aaggtggtctctttgggcctatacttcggtgagcaagcatacttgcgtagcagctggaac
gtcctggatggtttcctggtctttgtgtctatcatcgatatcgtggtatccgtggcctct
gcagggggagccaagatcctgggggtcctccgggtcctgcggctcctgcgtaccttacgt
cctttgagggtcatcagccgggcccctgggctgaagctggtggtagagacgctcatctcc
tccctcaagcccattggaaacattgtcctcatctgctgcgccttcttcatcatcttcggt
atcctgggggtgcagcttttcaaaggcaagttctatcactgtctgggagtggacacccga
aacatcaccaaccgatcagactgtgtggccgccaactaccgctgggtgcatcacaaatac
aactttgataacctgggccaggctttgatgtccctctttgtcttggcctccaaggatggc
tgggtgaacatcatgtataatggattggatgctgttgctgtggaccagcagccggtgaca
aaccacaacccctggatgctgctgtacttcatctccttcctgctcatcgtcagcttcttc
gtgctcaacatgttcgtgggagtggtcgtggagaacttccacaagtgccggcagcatcag
gaggctgaggaggcacggcggcgtgaggagaaacggctacggcgcctggaaaagaagcgc
cgtaaggctcagaggctgccctactatgccacctactgtcccacaagactgctcatccac
tccatgtgcactagccactacctggacatcttcatcaccttcatcatctgcctcaacgtg
gtcaccatgtccctggagcactacaaccagcctacatccctagagacagccctcaagtac
tgcaactacatgttcaccactgtctttgtgctggaggctgtgctgaagctggtggcgttt
ggcctgaggcgtttcttcaaggaccgatggaaccagctggacttggccattgtgctgctg
tctgtcatgggcatcacactggaggagattgagatcaatgcggccctgcccatcaacccc
accatcatccgtatcatgcgtgttctgcgtattgcccgggtgttgaagctgttgaagatg
gccacaggaatgcgggccctgctggacacagtggtacaggctctgccccaggtgggcaac
ctgggcctcctcttcatgctgctcttcttcatctacgccgctctgggagtggagctcttc
ggaaagctggtctgcaatgacgagaacccgtgtgagggcatgagccggcacgccaccttc
gagaacttcggcatggccttcctcacactcttccaggtctccacaggcgataactggaat
gggattatgaaggacactctgcgagactgcacccacgacgagcgcagctgcctgagcagc
ctgcagtttgtgtcgcctctctactttgtgagcttcgtactcacagcgcagtttgtgctc
atcaacgtggtggtggccgtgctgatgaaacatctggatgacagcaacaaggaggcccag
gaggatgcagagatggatgctgagatcgagctggagatggcccatggcctaggccccggg
cccggcccctgtccctgtccctgtccctgcccctgcccctgtccctgtcctggcccgagg
atgcccaccagttcaccgggggctccaggccgaggatcaggaggggcaggcgttggaggc
gacactgagagccacctgtgccggcactgctattctccagcccaggagaccctgtggctg
gacagcgtctctttaatcatcaaggactccttggagggggagctgaccatcattgacaac
ctgtctggctccatcttccaccactactcctcacctgccggctgtgacaagtgtcaccat
gacaagcaagaggtgcagctggctgagacagaggccttctccctgaactcagacaggtcc
tcgtccgtcctgctgggggatgacctgagtcttgaggaccccacggcctgcccgcagggc
cccaaggagagcaagggtgagctagagcctccggagcccatgcaggctggagacctggat
gaatgcttcttcccctttgccggtgagccagtgtctgcaggcccagagagcctgctgtgc
gagatgggggccattccattcaaccccgtccagtcctggctcaaacatgagagcaaccaa
gcacccccaagccctttctccccggatggttccagccctctgctgcagatgcctgctgag
ttcttccaccctgctgtgtctgccagccagaaggggcaggaaccgggcatgagttcaggg
accctgcccaagattgcacttcaggggtcctgggcatccctgaggtcaccgagtgtcaac
tgcaccctcttgcgccaggctactgtgagtgacacgtctttggatgccagccctagcagc
tcagcgggcagcctgcagaccacactggaggacagtctgaccctgagtgacagtcctcgg
cgtgccctgggaccaccagtccaggtgccagggccacgggctagcctgtcacctgccacc
cggcgccgcctcagcctgcgggggcgtggcctgtttagtctgcgtgggctgcgggcccat
cagcgtagccacagcagcggtggctccaccagccctggctgcacttaccacgactccatg
gacccctctgatgaggagggccgcgggggcgcaggtggtgggggcgcgggcagtgagcac
tccgagaccctcagcagcctgtcactcacatctctcttctgcctaccacccacgctgcca
ccacccggtctcaccccagccaggaagttcagcagtaccagcagcctggctgctggacct
ggccgtcctggcgccactgtctcggtccgcggcctggccaggagtccctcatgggctgca
gaccgcagcaaggacccaccaggccaggcacagctggcctccggcttcggctcctcagca
cccgagccacagccacctcccggggagtcaacggatgcggcgagcaaaaggaagagatga

DBGET integrated database retrieval system