KEGG   Mus musculus (mouse): 23956Help
Entry
23956             CDS       T01002                                 

Gene name
Neu2, MBS, MSS, MTS
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    23956 (Neu2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    23956 (Neu2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     23956 (Neu2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR CHB_HEX_C
Motif
Other DBs
NCBI-GeneID: 23956
NCBI-ProteinID: NP_001153636
MGI: 1344417
Ensembl: ENSMUSG00000079434
Vega: OTTMUSG00000036754
UniProt: Q9JMH3 Q0VGI4 Q3ULV6
LinkDB All DBs
Position
1; 1 D
AA seq 379 aa AA seqDB search
MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEHAELIVLRRGSYN
EATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEHHQLHTKVN
VTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAGSLLVPAYA
YRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYLNARSFL
GARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSVVAFHNPISKPHALDTWLLYTHPTDS
RNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMGQGPDGSPQFGCLYESGNYEE
IIFLIFTLKQAFPTVFDAQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgccctgtcctgcagaaggagacactgttccgcacaggcgtccatgcttac
agaatccctgctctgctctacctgaagaagcagaagaccctgctggcctttgcggaaaag
cgagccagcaagacggatgagcacgcagagttgattgtcctgagaagaggaagctacaac
gaagccaccaaccgtgtcaagtggcagcctgaggaagtggtgacccaagcccagctggaa
ggccaccgctccatgaatccatgtcccttgtatgacaagcaaacaaagaccctcttcctt
ttcttcatcgctgtccctgggcgtgtatcagaacatcatcagctccacactaaggttaat
gtcacacggctgtgctgtgtcagcagcactgaccatgggaggacctggagccccatccag
gacctcacagagaccaccattggcagcactcatcaggaatgggccacatttgctgtgggt
cctgggcattgtctgcagctgcggaacccagctgggagcctgctggtacctgcttatgcc
taccggaaactgcaccctgctcagaagcctaccccctttgccttctgcttcatcagcctt
gaccatgggcacacatggaaactaggcaactttgtggctgaaaactcactggagtgccag
gtggctgaggttggcactggagctcagaggatggtatatctcaatgctaggagcttcctg
ggagccagggtccaggcacaaagtcctaatgatggtctggatttccaggacaaccgggta
gtgagtaagcttgtagagcccccccacgggtgtcatggaagtgtggttgccttccacaac
cccatctctaagccacatgccttagacacatggcttctttatacacaccctacagactcc
aggaatagaaccaacctgggtgtgtacctaaaccagatgccactagatcccacagcctgg
tcagagcccaccctgctggccatgggcatctgtgcctactcagacttacagaacatgggg
caaggccctgatggctccccacagtttgggtgtctgtatgaatcaggtaactatgaagag
atcattttcctcatattcaccctgaagcaagctttccccactgtatttgatgcccagtga

DBGET integrated database retrieval system