KEGG   Mus musculus (mouse): 240354Help
Entry
240354            CDS       T01002                                 

Gene name
Malt1, A630046N12, D430033E09Rik, Pcasp1
Definition
(RefSeq) MALT1 paracaspase
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    240354 (Malt1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    240354 (Malt1)
   04660 T cell receptor signaling pathway
    240354 (Malt1)
   04662 B cell receptor signaling pathway
    240354 (Malt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    240354 (Malt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    240354 (Malt1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     240354 (Malt1)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   240354 (Malt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MALT1_Ig Ig_2 Ig_3 Peptidase_C14 I-set ig V-set Ig_5 Ig_4 Ig_6 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 240354
NCBI-ProteinID: NP_766421
MGI: 2445027
Ensembl: ENSMUSG00000032688
Vega: OTTMUSG00000014910
UniProt: Q2TBA3
LinkDB All DBs
Structure
PDB: 

Position
18; 18 E1
AA seq 821 aa AA seqDB search
MSLWGQPLQASPPLAVRQPPTASSGPSTSPPAGATLNRLPEPLLRRLSESLDRAPEGRGW
RQLAELAGSRGRLRLSGLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQALE
HTEVLPLLNPPGLKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPYGNSSE
LVFNTVHVKDAGFYVCRVNNSSTFEFSQWSQLDVCDVAEVTDSFQGSMDGISESRLQICV
EPRSQRLVPGSMLLLQCVAIGSPMPHYQWFKDESPLTHETKKHYTVPYVDIEHEGTYWCH
VYNDRDSQDSKKAEVTIDELNNLGHPDNKEQTGQPLAKDKVALLIGNMSYWEHPKLKAPL
VDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNS
FMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVT
ANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTK
GRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLG
FAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDL
PKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGLGR
KTCFQACRMPDEPYHSSTSTSAGAGHFHSSQDSFHDVYHSHLGNADSGMPPDRCHCSRTP
HTFISNYPPHHYCQFGRSNVPVETTDEMPFSFSDRLMISEN
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtgggggcagccgctgcaggcctcacctcccctggccgtgcggcagccccct
accgcgtcctcgggaccttcgacctcccctccagccggcgcaaccctcaaccgcctgccc
gagccgctgctgcggaggctcagcgagagcttggaccgcgctccggagggccggggctgg
cggcagctggccgagctggcgggcagtcggggacgcctccggctcagtggcctggacctg
gaacagtgttctcttaaagtattggagccagagggaagcccaagtttgtgtttattgaaa
ctaatgggtgaaaaaggatgtacagtcacagaactgagcgacttcctacaggctttggag
cacactgaggttcttccgcttctcaaccccccaggattaaagatcactgtaaacccagaa
tccaaggcagtgttggctggacagtttgtaaaactgtgctgccgggcaactggacatcct
tttgtacaatatcaatggttcaaaatgaataaagagatcccatatggaaattcatcagaa
cttgtttttaacacagtgcatgtaaaagatgcaggcttttatgtctgccgggttaacaac
agttccacttttgaatttagccagtggtcacagctggatgtgtgtgatgtggcagaagta
acagacagcttccagggaagtatggatggcatctcagaatccaggttgcaaatctgtgtt
gaaccaaggtcccaaaggctggtgccaggcagcatgttgttgttacagtgtgttgctatt
ggaagtcctatgcctcactaccagtggtttaaagatgaatcaccattaacacatgagaca
aaaaagcactacacggttccatatgtggatatagaacatgaaggaacctactggtgtcat
gtatataatgaccgagacagtcaagatagcaagaaggcagaagtcaccatagatgaatta
aacaatttggggcatcctgataataaagaacaaactggccagcctttggcaaaggacaaa
gtcgcccttttgatagggaatatgagttactgggagcatcccaagcttaaagcgcctttg
gtggatgtgtatgaattgaccaacttactaagacaactagatttcaaagttgtctcactg
ttggaccttactgaatatgagatgtgtaacgctgtggatgaatttttactacttttagac
aaaggagtatatggattgttatattatgcagggcacggttatgaaaactttggaaacagt
ttcatggtccctgttgatgctccaaatccatataggtctgaaaattgcctatgcgtacaa
aacatactgaaattaatgcaagaaaaggagactggcctgaatgtgttcctgttggatatg
tgtcggaaaagaaatgactacgatgataccattccaatcttggacgcactgaaagtcact
gccaacattgtgtttggatatgccacgtgccaaggagcagaagcctttgaaatccagcat
tctgggttggcaaatgggatttttatgaaatttttaaaagatagattattagaagacaag
aaaattactgtgttactggatgaagttgcagaagatatgggtaaatgtcaccttaccaaa
ggcagacaagctctagagattcgcagcagcttgtctgaaaagagagcacttactgatcca
gtccagggagcaccttgctctgcagaggctctggtgcgcaatctacagtgggccaaggct
catgaacttccagaaagtatgtgccttaaatttcagtgtggcgttcacattcaattagga
tttgccgcagagttctccaatgtcatgataatctacacaagtatagtccacaaaccacct
gagataataatgtgtgacgcctatgttactgatttccctcttgacctagatattgatcca
aaacatgcaaacaaggggactcctgaagaaactggcagctacttagtatcaaaagacctt
cccaagcactgcctctacactagactcagctcactacaaaaattaaaggaacatctgatc
ttcacagtctgtctgtcctatcagtattcaggactagaagacactgtggaggagaagcag
gaggtgaacgtggggaagcctcttattgccaagctagacatgcaccgaggactgggcagg
aagacttgcttccaagcttgtcgtatgcctgacgagccgtaccacagctccacatctacc
tcagcgggagcggggcatttccattcctctcaggactcattccatgatgtgtaccattca
catcttggcaatgcagacagtggtatgccaccagacaggtgtcattgcagccggactcca
cacacattcatttcaaattatcccccccaccactactgccagtttggtagaagtaatgtg
cccgtagagacaactgatgaaatgccattcagtttttctgacaggcttatgatttctgaa
aactga

DBGET integrated database retrieval system