KEGG   Mus musculus (mouse): 24069Help
Entry
24069             CDS       T01002                                 

Gene name
Sufu, Su(fu)
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    24069 (Sufu)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24069 (Sufu)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    24069 (Sufu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUFU_C SUFU
Motif
Other DBs
NCBI-GeneID: 24069
NCBI-ProteinID: NP_001020562
MGI: 1345643
Ensembl: ENSMUSG00000025231
Vega: OTTMUSG00000030508
UniProt: Q9Z0P7
LinkDB All DBs
Position
19 C3; 19 38.85 cM
AA seq 484 aa AA seqDB search
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR
GETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRRL
SGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHEL
IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
SPLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgcggcctagcgtcgcccccggtcccgccgcgcccccggcctctggccct
agtgcccctccggcctttgcttcactctttcccccgggactgcacgccatctacggagag
tgtcgccgcctctaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggtccggaccccttggactatgttagcatgtacaggaacatggggagtcct
tctgccaacatccctgagcactggcactacatcagctttggcctgagtgatctctatggt
gacaacagagtccatgagtttacaggaacagacggaccaagtggatttggctttgagttg
acgtttcgtctgaagagagaaactggggagtctgccccaccaacatggccagcagagctg
atgcagggcctagcccgatatgtcttccagtcagagaacaccttctgtagcggggaccat
gtgtcttggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgacg
gaggacccacagatgcagcctgtgcggacaccctttggggtagtgactttcctccagatt
gttggtgtctgcactgaggagttacattcagcccaacagtggaacgggcagggcatcctg
gaactactacggacagtgcccattgctggcggtccctggctgataactgacatgcggcgg
ggagaaaccatatttgagatcgatccgcacctgcaagagagagttgacaaaggcattgag
acagacggttctaacctgagcggcgtcagtgccaagtgtgcctgggatgacctcagccgg
cctccggaggatgaagaggatagccggagcatctgcctcggcacacagcctcggaggctg
tctggcaaagacacagagcagatccgggagaccctgaggcggggactggagattaacagc
aaacctgtccttccaccaatcaattctcagcgacagaacggcctcacccacgacagggct
ccgagccgcaaggacagtttgggcagcgacagctccacggccatcatcccccacgagctg
atccgcacacggcagctcgagagcgtgcatctaaaatttaaccaagagtcgggagccctc
atccctctctgcctaaggggcagactcctacatggccggcacttcacctacaagagtatc
acaggcgacatggccatcacgtttgtgtccacgggagtggaaggcgcctttgccactgag
gaacacccgtatgcagctcacggaccctggttacaaattctgttgacagaagagtttgta
gagaagatgttggaggacttagaagatctaacctctccagaggaatttaaacttcccaaa
gagtacagctggcctgagaagaaactcaaagtgtccattctccccgacgtggtgttcgac
agtccactgcactag

DBGET integrated database retrieval system